Citrus Sinensis ID: 023571


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
METILTTTASKLTIFHSISSTKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGVQASASQAAASSTEAEPTKVGTVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
cccEEEcccccccccccccccccccEEEEEEEccccccccccccccccccEEccccccccEEEEEEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccEEEEEcccccHHHHHHccccEEEEccccccccccccccEEEEccccHHHHHHHHccccEEEEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHccccccEEEEEcc
ccHHHHcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEccccccccEEEEccccccccEEHEEEEcccccHHHHccccccHHHHHHHHHHHHccccEEEEccccccccEHHHHHHHcccEEEEEccHHHHHHHHHccccEEEEcccccHHHHHccccEEEEccccHHHHHHEEccccEEEEEEccccccHEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHccccccEEEEEEcc
metiltttASKLTIFHSIsstklnsfsrkfsvgfsgnknrkkvttlkqgsfsylplgvqasasqaaassteaeptkvgtvpseMKAWLYgeyggvdvlkfdekvtvpqvkedQVLIKVVAAAlnpvdgkrrqgkfkatdsplptvpgydvaatsstrNLEFLKSLGADLAIdytkdnfedlpekFDVVYDAIGQCDRAVKAIKEGGTVValtgavtppgfrfvvTSNGevlkklnpylesgkvkpiidpkgpfpfsQVVEAFSYIEtnkatgkvvihpip
metiltttaskltifhsisstklnsfsrkfsvgfsgnknrkkvTTLKQGSFSYLPLGVQASASQAAAssteaeptkvgtvpSEMKAWLYGEYGGVDVLKFDEKVTVpqvkedqvLIKVVAAalnpvdgkrrqgkfkatdsplptvpgYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVValtgavtppgfrfvVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIetnkatgkvvihpip
METILTTTASKLTIFHSISSTKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGVqasasqaaassTEAEPTKVGTVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
*********SKLTIFHSISSTKL**F***FSV******************FSYL*****************************MKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPV********************GYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVI****
***ILTTTASKLTIFHSI*STKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGVQASASQAAASSTEAEPTKVGTVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
METILTTTASKLTIFHSISSTKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGV********************TVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
**********KLTIFHSISSTKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGVQASASQAAASSTEAEPTKVGTVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METILTTTASKLTIFHSISSTKLNSFSRKFSVGFSGNKNRKKVTTLKQGSFSYLPLGVQASASQAAASSTEAEPTKVGTVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNKATGKVVIHPIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q9ZUC1386 Quinone oxidoreductase-li yes no 0.467 0.339 0.801 3e-59
Q28452 330 Quinone oxidoreductase OS N/A no 0.242 0.206 0.463 4e-07
O97764 330 Zeta-crystallin OS=Bos ta yes no 0.242 0.206 0.463 1e-06
Q9SV68329 Putative quinone-oxidored no no 0.439 0.373 0.296 2e-06
P11415 329 Quinone oxidoreductase OS yes no 0.275 0.234 0.409 3e-06
O42909347 Zinc-type alcohol dehydro yes no 0.45 0.363 0.264 6e-06
Q6AYT0 329 Quinone oxidoreductase OS yes no 0.242 0.206 0.434 7e-06
Q8H0M1 329 Quinone-oxidoreductase ho N/A no 0.239 0.203 0.457 7e-06
P47199 331 Quinone oxidoreductase OS yes no 0.242 0.205 0.434 1e-05
Q08257 329 Quinone oxidoreductase OS no no 0.242 0.206 0.434 1e-05
>sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=1 SV=2 Back     alignment and function desciption
 Score =  228 bits (582), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 122/131 (93%)

Query: 150 VAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVV 209
           VAAT+ST  LE ++SLGADLAIDYTK+N EDLP+K+DVV+DAIG CD+AVK IKEGG VV
Sbjct: 256 VAATASTEKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVV 315

Query: 210 ALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNK 269
           ALTGAVTPPGFRFVVTSNG+VLKKLNPY+ESGKVKP++DPKGPFPFS+V +AFSY+ETN 
Sbjct: 316 ALTGAVTPPGFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNH 375

Query: 270 ATGKVVIHPIP 280
           ATGKVV++PIP
Sbjct: 376 ATGKVVVYPIP 386





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 Back     alignment and function description
>sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 Back     alignment and function description
>sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 Back     alignment and function description
>sp|O42909|YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 Back     alignment and function description
>sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 Back     alignment and function description
>sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 Back     alignment and function description
>sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=2 SV=1 Back     alignment and function description
>sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
255568816 389 alcohol dehydrogenase, putative [Ricinus 0.442 0.318 0.923 5e-66
356526809 397 PREDICTED: quinone oxidoreductase-like p 0.45 0.317 0.893 4e-64
356567630 395 PREDICTED: quinone oxidoreductase-like p 0.45 0.318 0.885 2e-63
388495252 387 unknown [Lotus japonicus] 0.442 0.320 0.885 4e-63
359473178377 PREDICTED: quinone oxidoreductase-like p 0.414 0.307 0.870 5e-62
297739033309 unnamed protein product [Vitis vinifera] 0.467 0.423 0.870 8e-62
307135978 383 alcohol dehydrogenase [Cucumis melo subs 0.428 0.313 0.862 2e-61
118488941 383 unknown [Populus trichocarpa x Populus d 0.421 0.308 0.854 3e-61
224140597309 predicted protein [Populus trichocarpa] 0.467 0.423 0.854 5e-61
449434925 383 PREDICTED: quinone oxidoreductase-like p 0.428 0.313 0.854 2e-60
>gi|255568816|ref|XP_002525379.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223535342|gb|EEF37017.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (97%)

Query: 150 VAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVV 209
           VAATS TRNLE LKSLGADLAIDYTK+NFEDLPEKFDVVYDAIGQCDRAVKA+KEGG+VV
Sbjct: 259 VAATSGTRNLEILKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEGGSVV 318

Query: 210 ALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNK 269
           ALTGAVTPPGFRFVVTSNG+VLKKLNPYLESGKVKP+IDPKGPFPFSQV EAFSYIETN+
Sbjct: 319 ALTGAVTPPGFRFVVTSNGDVLKKLNPYLESGKVKPVIDPKGPFPFSQVAEAFSYIETNR 378

Query: 270 ATGKVVIHPIP 280
           ATGK+VIHPIP
Sbjct: 379 ATGKIVIHPIP 389




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356526809|ref|XP_003532009.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356567630|ref|XP_003552020.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|388495252|gb|AFK35692.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|359473178|ref|XP_003631255.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739033|emb|CBI28522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135978|gb|ADN33837.1| alcohol dehydrogenase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|118488941|gb|ABK96279.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224140597|ref|XP_002323668.1| predicted protein [Populus trichocarpa] gi|222868298|gb|EEF05429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434925|ref|XP_004135246.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2034802386 AOR "alkenal/one oxidoreductas 0.467 0.339 0.801 9.1e-88
TIGR_CMR|BA_3566332 BA_3566 "alcohol dehydrogenase 0.278 0.234 0.349 7.6e-21
TIGR_CMR|BA_3438335 BA_3438 "alcohol dehydrogenase 0.171 0.143 0.448 7.7e-17
UNIPROTKB|Q0VC50 396 RTN4IP1 "Reticulon-4-interacti 0.192 0.136 0.392 1.2e-13
TIGR_CMR|BA_0176302 BA_0176 "alcohol dehydrogenase 0.428 0.397 0.310 3.7e-13
UNIPROTKB|F1RT47 396 LOC100627610 "Uncharacterized 0.192 0.136 0.392 1.4e-12
UNIPROTKB|G5EH83339 MGCH7_ch7g170 "Uncharacterized 0.275 0.227 0.318 9.6e-12
TAIR|locus:2123206 329 AT4G13010 [Arabidopsis thalian 0.242 0.206 0.362 9.9e-12
POMBASE|SPBC16A3.02c347 SPBC16A3.02c "mitochondrial co 0.242 0.195 0.378 1.2e-11
TIGR_CMR|CBU_1023 318 CBU_1023 "alcohol dehydrogenas 0.235 0.207 0.442 1.6e-11
TAIR|locus:2034802 AOR "alkenal/one oxidoreductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 574 (207.1 bits), Expect = 9.1e-88, Sum P(2) = 9.1e-88
 Identities = 105/131 (80%), Positives = 122/131 (93%)

Query:   150 VAATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVV 209
             VAAT+ST  LE ++SLGADLAIDYTK+N EDLP+K+DVV+DAIG CD+AVK IKEGG VV
Sbjct:   256 VAATASTEKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVV 315

Query:   210 ALTGAVTPPGFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNK 269
             ALTGAVTPPGFRFVVTSNG+VLKKLNPY+ESGKVKP++DPKGPFPFS+V +AFSY+ETN 
Sbjct:   316 ALTGAVTPPGFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNH 375

Query:   270 ATGKVVIHPIP 280
             ATGKVV++PIP
Sbjct:   376 ATGKVVVYPIP 386


GO:0000166 "nucleotide binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0035671 "enone reductase activity" evidence=IDA
GO:0035798 "2-alkenal reductase (NADP+) activity" evidence=IDA
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009416 "response to light stimulus" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
TIGR_CMR|BA_3566 BA_3566 "alcohol dehydrogenase, zinc-containing" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3438 BA_3438 "alcohol dehydrogenase, zinc-containing" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC50 RTN4IP1 "Reticulon-4-interacting protein 1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0176 BA_0176 "alcohol dehydrogenase, zinc-containing" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT47 LOC100627610 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5EH83 MGCH7_ch7g170 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2123206 AT4G13010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC16A3.02c SPBC16A3.02c "mitochondrial conserved protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1023 CBU_1023 "alcohol dehydrogenase, zinc-containing" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZUC1QORL_ARATH1, ., -, ., -, ., -0.80150.46780.3393yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 1e-32
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 2e-30
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 4e-23
pfam13602129 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenas 1e-22
cd05289 309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 9e-19
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 1e-18
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 3e-17
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 8e-15
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 3e-14
cd08253 325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 4e-14
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 5e-14
COG0604 326 COG0604, Qor, NADPH:quinone reductase and related 1e-13
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 4e-13
cd08272 326 cd08272, MDR6, Medium chain dehydrogenases/reducta 1e-12
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 2e-12
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 6e-12
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 1e-11
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 3e-11
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 1e-10
cd08248 350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 3e-10
cd08271 325 cd08271, MDR5, Medium chain dehydrogenases/reducta 3e-10
cd08267 319 cd08267, MDR1, Medium chain dehydrogenases/reducta 4e-10
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 7e-10
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 7e-10
cd08268 328 cd08268, MDR2, Medium chain dehydrogenases/reducta 1e-09
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 1e-09
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 1e-09
cd08249 339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 2e-09
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 2e-09
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 6e-09
PTZ00354 334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 6e-09
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 9e-09
cd05286 320 cd05286, QOR2, Quinone oxidoreductase (QOR) 1e-08
cd05276 323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 3e-08
cd08274 350 cd08274, MDR9, Medium chain dehydrogenases/reducta 4e-08
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 4e-08
cd08252 336 cd08252, AL_MDR, Arginate lyase and other MDR fami 7e-08
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 1e-07
cd08275 337 cd08275, MDR3, Medium chain dehydrogenases/reducta 2e-07
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 2e-07
cd08241 323 cd08241, QOR1, Quinone oxidoreductase (QOR) 3e-07
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 3e-07
cd08266 342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 4e-07
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 4e-07
TIGR02824 325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 7e-07
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 8e-07
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 1e-06
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 3e-06
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 4e-06
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 7e-06
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 8e-06
cd08264 325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 1e-05
cd08290 341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 3e-05
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 4e-05
smart00829287 smart00829, PKS_ER, Enoylreductase 4e-05
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 5e-05
cd05280 325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 6e-05
cd08251303 cd08251, polyketide_synthase, polyketide synthase 6e-05
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 7e-05
cd08276 336 cd08276, MDR7, Medium chain dehydrogenases/reducta 8e-05
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 1e-04
cd08243 320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 6e-04
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 7e-04
cd08291 324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 9e-04
cd05284 340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 0.001
cd08246 393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 0.001
cd05279 365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 0.001
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 0.002
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 0.002
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 0.002
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 0.003
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
 Score =  121 bits (305), Expect = 1e-32
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 15/143 (10%)

Query: 147 GYDVAATSSTRNLEFLKSLGADLAIDYTKDNFE--DLPEKFDVVYDAIGQ--CDRAVKAI 202
           G  V AT+S  N +FL+SLGAD  IDYTK +FE    P   D V D +G     R++  +
Sbjct: 169 GARVIATASAANADFLRSLGADEVIDYTKGDFERAAAPGGVDAVLDTVGGETLARSLALV 228

Query: 203 KEGGTVVALTGAVTPP---------GFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPF 253
           K GG +V++ G                   V  +GE L +L   +E+GK++P++D    F
Sbjct: 229 KPGGRLVSIAGPPPAEQAAKRRGVRAGFVFVEPDGEQLAELAELVEAGKLRPVVD--RVF 286

Query: 254 PFSQVVEAFSYIETNKATGKVVI 276
           P     EA   +E+  A GKVV+
Sbjct: 287 PLEDAAEAHERLESGHARGKVVL 309


Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 309

>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|222256 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.97
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 99.94
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.93
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.93
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 99.92
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 99.89
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.89
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 99.88
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.87
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.87
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.87
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.86
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 99.86
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.85
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.84
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.84
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.83
PLN02178375 cinnamyl-alcohol dehydrogenase 99.83
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.83
PLN02740381 Alcohol dehydrogenase-like 99.83
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.83
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.82
PLN02514357 cinnamyl-alcohol dehydrogenase 99.82
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.81
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.81
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.81
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.81
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.81
PLN02827378 Alcohol dehydrogenase-like 99.81
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.81
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.8
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.8
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.79
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.79
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.79
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.79
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.78
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.78
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.77
PRK10083339 putative oxidoreductase; Provisional 99.76
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.76
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.76
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.75
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.75
PTZ00354334 alcohol dehydrogenase; Provisional 99.74
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.74
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 99.74
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.74
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.73
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.73
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.72
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.72
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.72
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.72
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.71
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.71
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.71
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.7
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.7
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.7
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.7
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.7
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.7
PRK13771334 putative alcohol dehydrogenase; Provisional 99.69
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.69
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.69
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.69
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.69
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.68
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.68
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.68
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.67
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.67
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.67
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.67
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.67
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.67
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.67
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.67
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.66
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.65
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.65
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.64
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.64
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.64
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.64
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.64
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.64
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.64
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.64
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.63
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.63
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.63
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.63
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.63
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.62
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.61
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.6
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.59
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.58
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.58
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.58
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.57
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.57
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.57
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.57
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.56
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.56
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.56
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.56
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.56
PLN02702364 L-idonate 5-dehydrogenase 99.55
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.55
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.53
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.51
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.5
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.5
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.49
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.49
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.36
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.34
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.33
cd08258 306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.29
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.16
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 98.93
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 98.57
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 98.46
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 98.45
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 98.23
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.64
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.38
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 93.06
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 91.42
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 89.28
PF1382323 ADH_N_assoc: Alcohol dehydrogenase GroES-associate 87.72
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 82.31
PRK08306296 dipicolinate synthase subunit A; Reviewed 81.76
PLN02494477 adenosylhomocysteinase 80.67
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=99.97  E-value=5.6e-30  Score=228.70  Aligned_cols=192  Identities=30%  Similarity=0.446  Sum_probs=168.7

Q ss_pred             ccceeEEEEcccCCCccEEEeeeccCCCCCCCcEEEEEEEEecChHHHHHHcCCCCCCCCCCCcccCceE----------
Q 023571           81 PSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDV----------  150 (280)
Q Consensus        81 p~~mka~~~~~~g~~~~l~l~~~~~~p~~~~~eVlVkV~aagl~~~D~~~~~g~~~~~~~~~P~i~G~e~----------  150 (280)
                      |.+|||+++.+++++  +++. +++.|+|++|||+|+|+|||||++|+|.++|.++  ...+|.++|||+          
T Consensus         1 ~~~mkA~~~~~~~~p--l~i~-e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~--~~~~P~ipGHEivG~V~~vG~~   75 (339)
T COG1064           1 MMTMKAAVLKKFGQP--LEIE-EVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWP--VPKLPLIPGHEIVGTVVEVGEG   75 (339)
T ss_pred             CcceEEEEEccCCCC--ceEE-eccCCCCCCCeEEEEEEEEeecchhhhhhcCCCC--CCCCCccCCcceEEEEEEecCC
Confidence            457999999999988  8889 9999999999999999999999999999999997  456999999999          


Q ss_pred             --------------------------------------------------------------------------------
Q 023571          151 --------------------------------------------------------------------------------  150 (280)
Q Consensus       151 --------------------------------------------------------------------------------  150 (280)
                                                                                                      
T Consensus        76 V~~~k~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT~  155 (339)
T COG1064          76 VTGLKVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITT  155 (339)
T ss_pred             CccCCCCCEEEecCccCCCCCCccccCcccccCCCccccceeecCcceeEEEEchHHeEECCCCCChhhhhhhhcCeeeE
Confidence                                                                                            


Q ss_pred             ---------------------------------------EEecChhhHHHHHhCCCCEEEeCCCCCccccC-CCccEEEe
Q 023571          151 ---------------------------------------AATSSTRNLEFLKSLGADLAIDYTKDNFEDLP-EKFDVVYD  190 (280)
Q Consensus       151 ---------------------------------------~~~~s~~~~~~l~~lga~~vid~~~~~~~~~~-~g~DvV~d  190 (280)
                                                             +.+.+++|++++++||+|++++.+++++.+.. +.+|+++|
T Consensus       156 y~alk~~~~~pG~~V~I~G~GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~~~~~~~~~~~~~d~ii~  235 (339)
T COG1064         156 YRALKKANVKPGKWVAVVGAGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSSDSDALEAVKEIADAIID  235 (339)
T ss_pred             eeehhhcCCCCCCEEEEECCcHHHHHHHHHHHHcCCeEEEEeCChHHHHHHHHhCCcEEEEcCCchhhHHhHhhCcEEEE
Confidence                                                   78899999999999999999998877666654 34999999


Q ss_pred             CCC--CHHHHHhccccCCEEEEEcCCC-CC-Cce------------EEEEeecHHHHHHHHHHHHCCCceeecCCCcccc
Q 023571          191 AIG--QCDRAVKAIKEGGTVVALTGAV-TP-PGF------------RFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFP  254 (280)
Q Consensus       191 ~~g--~~~~~l~~l~~gG~vV~~g~~~-~~-~~~------------~~~~~~~~~~l~~l~~ll~~G~l~~~~~~~~~~~  254 (280)
                      +++  .++.++++|+++|+++.+|... .+ ..+            .-++...+.++++++++.++|++++.+..  .++
T Consensus       236 tv~~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~~g~~~d~~e~l~f~~~g~Ikp~i~e--~~~  313 (339)
T COG1064         236 TVGPATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRADLEEALDFAAEGKIKPEILE--TIP  313 (339)
T ss_pred             CCChhhHHHHHHHHhcCCEEEEECCCCCcccCCCCHHHhhhcCeEEEEEecCCHHHHHHHHHHHHhCCceeeEEe--eEC
Confidence            998  7899999999999999999884 22 111            12344468999999999999999999843  899


Q ss_pred             hhhHHHHHHHHHhCCCCeeEEEEeC
Q 023571          255 FSQVVEAFSYIETNKATGKVVIHPI  279 (280)
Q Consensus       255 l~~v~~A~~~l~~~~~~gkvVv~~~  279 (280)
                      ++|+++|++.|++++..|++||++.
T Consensus       314 l~~in~A~~~m~~g~v~gR~Vi~~~  338 (339)
T COG1064         314 LDEINEAYERMEKGKVRGRAVIDMS  338 (339)
T ss_pred             HHHHHHHHHHHHcCCeeeEEEecCC
Confidence            9999999999999999999999764



>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1yb5_A 351 Crystal Structure Of Human Zeta-crystallin With Bou 1e-06
3tqh_A 321 Structure Of The Quinone Oxidoreductase From Coxiel 8e-05
3tqh_A321 Structure Of The Quinone Oxidoreductase From Coxiel 8e-05
2x7h_A370 Crystal Structure Of The Human Mgc45594 Gene Produc 8e-05
2wek_A341 Crystal Structure Of The Human Mgc45594 Gene Produc 9e-05
2c0c_A362 Structure Of The Mgc45594 Gene Product Length = 362 9e-05
2vn8_A375 Crystal Structure Of Human Reticulon 4 Interacting 2e-04
3gaz_A343 Crystal Structure Of An Alcohol Dehydrogenase Super 2e-04
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/69 (43%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Query: 84 MKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP 143 M+A E+GG +VLK + VP K+ QVLIKV A +NPV+ R G + + LP Sbjct: 30 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTY-SRKPLLP 88 Query: 144 TVPGYDVAA 152 PG DVA Sbjct: 89 YTPGSDVAG 97
>pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 Back     alignment and structure
>pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 Back     alignment and structure
>pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 Back     alignment and structure
>pdb|2VN8|A Chain A, Crystal Structure Of Human Reticulon 4 Interacting Protein 1 In Complex With Nadph Length = 375 Back     alignment and structure
>pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 7e-39
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-21
3fbg_A346 Putative arginate lyase; structural genomics, unkn 5e-30
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 5e-15
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 9e-30
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 1e-19
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 2e-28
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 1e-17
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 6e-27
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 7e-20
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 5e-26
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 2e-17
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 8e-24
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 9e-15
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 7e-23
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 3e-14
3krt_A456 Crotonyl COA reductase; structural genomics, prote 9e-22
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 4e-09
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 9e-22
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 5e-12
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 1e-21
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 3e-11
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 7e-18
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 2e-13
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 4e-17
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 3e-09
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 4e-17
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 3e-14
4eye_A342 Probable oxidoreductase; structural genomics, niai 8e-17
4eye_A 342 Probable oxidoreductase; structural genomics, niai 6e-12
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 1e-16
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 3e-16
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 3e-16
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 8e-12
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 5e-16
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 1e-13
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-15
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 4e-13
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 2e-15
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 1e-08
3gms_A340 Putative NADPH:quinone reductase; structural genom 2e-14
3gms_A 340 Putative NADPH:quinone reductase; structural genom 3e-13
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 2e-13
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 5e-12
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 3e-13
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 9e-11
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 5e-13
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 1e-12
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 8e-11
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 6e-12
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 2e-11
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 9e-12
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 3e-11
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 1e-11
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 7e-11
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 9e-05
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 8e-10
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 3e-09
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 4e-09
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 1e-07
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 1e-07
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 2e-07
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 2e-07
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-07
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 2e-07
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 5e-04
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 3e-07
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 3e-07
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 8e-07
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 6e-05
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 2e-05
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 3e-05
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 7e-05
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
 Score =  137 bits (347), Expect = 7e-39
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 16/141 (11%)

Query: 150 VAATSSTRNLEFLKSLGADLAIDYTKDNFED-LPEKFDVVYDAIGQ--CDRAVKAIKEGG 206
           V  T+S RN  FLK+LGA+  I+Y +++F   +    D V D +G     +++  +KE G
Sbjct: 180 VITTASKRNHAFLKALGAEQCINYHEEDFLLAISTPVDAVIDLVGGDVGIQSIDCLKETG 239

Query: 207 TVVALTGAVTPP-----------GFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPF 255
            +V++                   F  +   N E L  L   +   K++  I     F  
Sbjct: 240 CIVSVPTITAGRVIEVAKQKHRRAFGLLKQFNIEELHYLGKLVSEDKLRIEIS--RIFQL 297

Query: 256 SQVVEAFSYIETNKATGKVVI 276
           S+ V A   +ET    GK+V 
Sbjct: 298 SEAVTAHELLETGHVRGKLVF 318


>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.96
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.96
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.96
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.95
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.95
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.95
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.95
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.95
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.95
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.95
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.95
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.94
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.94
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.94
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.94
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.94
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.93
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.93
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.93
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.93
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.93
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.93
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.93
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.93
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.93
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.92
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.92
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.92
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.92
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.92
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.92
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.92
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.92
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.92
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.92
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.92
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.91
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.91
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.91
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.91
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.91
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.91
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.91
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.91
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.91
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.91
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.9
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.9
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.9
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.9
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.9
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.9
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.9
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.89
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.89
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.89
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.89
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.89
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.89
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.88
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.86
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.86
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.86
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.85
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.85
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.85
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.84
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.81
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.78
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.57
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.36
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.88
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.77
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 88.85
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 87.97
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 87.94
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 81.71
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
Probab=99.96  E-value=3e-28  Score=220.90  Aligned_cols=188  Identities=20%  Similarity=0.201  Sum_probs=159.5

Q ss_pred             eeEEEEcccCCCccEEEeeeccCCCCCCCcEEEEEEEEecChHHHHHHcCCCCCCCCCCCcccCceE-------------
Q 023571           84 MKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDV-------------  150 (280)
Q Consensus        84 mka~~~~~~g~~~~l~l~~~~~~p~~~~~eVlVkV~aagl~~~D~~~~~g~~~~~~~~~P~i~G~e~-------------  150 (280)
                      |||+++...+ +..++++ |.|.|+|++|||||||.|+|||++|++++.|.++   ..+|.++|||+             
T Consensus         1 MKA~v~~~~~-~~~~~l~-e~~~P~~~p~eVLVkv~a~gic~~D~~~~~G~~~---~~~p~i~GhE~aG~V~~vG~~V~~   75 (348)
T 4eez_A            1 MKAAVVRHNP-DGYADLV-EKELRAIKPNEALLDMEYCGVCHTDLHVAAGDFG---NKAGTVLGHEGIGIVKEIGADVSS   75 (348)
T ss_dssp             CEEEEECSSC-CSSEEEE-ECCCCCCCTTEEEEEEEEEECCHHHHHHHTTTTC---CCTTCBCCSEEEEEEEEECTTCCS
T ss_pred             CeEEEEEcCC-CCcEEEE-EeECCCCCCCEEEEEEEEEEECHHHHHHhcCCCC---CCCCcccceeEEEEEEEECceeee
Confidence            8999986533 2458999 9999999999999999999999999999999885   46899999999             


Q ss_pred             --------------------------------------------------------------------------------
Q 023571          151 --------------------------------------------------------------------------------  150 (280)
Q Consensus       151 --------------------------------------------------------------------------------  150 (280)
                                                                                                      
T Consensus        76 ~~~GdrV~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~G~~ae~~~~~~~~~~~iP~~~~~~~aa~l~~~~~ta~~~  155 (348)
T 4eez_A           76 LQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKA  155 (348)
T ss_dssp             CCTTCEEEEESEEECCSSSHHHHTTCGGGCTTCEEBTTTBCCSSBSEEEEEGGGSCBCCTTSCHHHHHHHHHHHHHHHHH
T ss_pred             cccCCeEeecccccccCccccccCCcccccccccccccccCCcceeeccccccceeecCCCCCHHHHhhcccceeeEEee
Confidence                                                                                            


Q ss_pred             -------------------------------------EEecChhhHHHHHhCCCCEEEeCCCCCccccC------CCccE
Q 023571          151 -------------------------------------AATSSTRNLEFLKSLGADLAIDYTKDNFEDLP------EKFDV  187 (280)
Q Consensus       151 -------------------------------------~~~~s~~~~~~l~~lga~~vid~~~~~~~~~~------~g~Dv  187 (280)
                                                           +++.+++|+++++++|++++|||+++++.+.+      .++|+
T Consensus       156 l~~~~~~~g~~VlV~GaG~~g~~a~~~a~~~~g~~Vi~~~~~~~r~~~~~~~Ga~~~i~~~~~~~~~~v~~~t~g~g~d~  235 (348)
T 4eez_A          156 IKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVTINSGDVNPVDEIKKITGGLGVQS  235 (348)
T ss_dssp             HHHHTCCTTCEEEEECCSHHHHHHHHHHHHTSCCEEEEEESCHHHHHHHHHTTCSEEEEC-CCCHHHHHHHHTTSSCEEE
T ss_pred             ecccCCCCCCEEEEEcCCCccHHHHHHHHHhCCCEEEEEECcHHHhhhhhhcCCeEEEeCCCCCHHHHhhhhcCCCCceE
Confidence                                                 56778999999999999999999998876642      58999


Q ss_pred             EEeCCC---CHHHHHhccccCCEEEEEcCCCCCCc------------eEEEEeecHHHHHHHHHHHHCCCceeecCCCcc
Q 023571          188 VYDAIG---QCDRAVKAIKEGGTVVALTGAVTPPG------------FRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGP  252 (280)
Q Consensus       188 V~d~~g---~~~~~l~~l~~gG~vV~~g~~~~~~~------------~~~~~~~~~~~l~~l~~ll~~G~l~~~~~~~~~  252 (280)
                      ++||+|   .+..++++++++|+++.+|.......            +.......+++++++++++++|++++.+   ++
T Consensus       236 ~~~~~~~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~gs~~~~~~~~~~~~~l~~~g~i~p~~---~~  312 (348)
T 4eez_A          236 AIVCAVARIAFEQAVASLKPMGKMVAVAVPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIV---AT  312 (348)
T ss_dssp             EEECCSCHHHHHHHHHTEEEEEEEEECCCCSCEEEECHHHHHHSCCEEEECCSCCHHHHHHHHHHHHTTSCCCCE---EE
T ss_pred             EEEeccCcchhheeheeecCCceEEEEeccCCCCccCHHHHHhCCeEEEEEecCCHHHHHHHHHHHHcCCCEEEE---EE
Confidence            999987   48899999999999999987653221            1122334578899999999999999754   38


Q ss_pred             cchhhHHHHHHHHHhCCCCeeEEEEeC
Q 023571          253 FPFSQVVEAFSYIETNKATGKVVIHPI  279 (280)
Q Consensus       253 ~~l~~v~~A~~~l~~~~~~gkvVv~~~  279 (280)
                      |+|+|+++|++.+++++..||+||+++
T Consensus       313 ~~l~~~~~A~~~l~~g~~~GKvVl~~s  339 (348)
T 4eez_A          313 RKLEEINDIIDEMKAGKIEGRMVIDFT  339 (348)
T ss_dssp             ECGGGHHHHHHHHHTTCCSSEEEEECC
T ss_pred             EeHHHHHHHHHHHHCCCCccEEEEEcc
Confidence            999999999999999999999999885



>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 1e-11
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 5e-09
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 7e-09
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 9e-09
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 4e-08
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 2e-07
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 3e-07
d1qora1147 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas 2e-06
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 3e-06
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 3e-06
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 7e-06
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 7e-06
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 9e-06
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 2e-05
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 2e-05
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 6e-05
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 7e-05
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 1e-04
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 2e-04
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 3e-04
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 5e-04
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 0.001
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 0.001
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Quinone oxidoreductase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.3 bits (142), Expect = 1e-11
 Identities = 29/67 (43%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 84  MKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP 143
           M+A    E+GG +VLK    + VP  K+ QVLIKV A  +NPV+   R G +      LP
Sbjct: 3   MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS-RKPLLP 61

Query: 144 TVPGYDV 150
             PG DV
Sbjct: 62  YTPGSDV 68


>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.48
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.4
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.37
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.36
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.35
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.33
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.32
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.32
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.32
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.31
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.3
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.3
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.3
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.26
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.24
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.22
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.2
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.19
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.16
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.16
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.03
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 98.98
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.98
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 98.97
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.97
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.96
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 98.95
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.94
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.94
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.93
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 98.9
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.86
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 98.86
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.84
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 98.83
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 98.8
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 98.75
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.74
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 98.7
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.64
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.62
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.59
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 98.57
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.56
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.52
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.51
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.51
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.48
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.32
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.17
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 97.8
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.2
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 81.93
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 81.4
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 80.32
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Alcohol dehydrogenase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.48  E-value=3.4e-14  Score=114.46  Aligned_cols=69  Identities=33%  Similarity=0.563  Sum_probs=62.8

Q ss_pred             CcccceeEEEEcccCCCccEEEeeeccCCCCCCCcEEEEEEEEecChHHHHHHcCCCCCCCCCCCcccCceEE
Q 023571           79 TVPSEMKAWLYGEYGGVDVLKFDEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPTVPGYDVA  151 (280)
Q Consensus        79 ~~p~~mka~~~~~~g~~~~l~l~~~~~~p~~~~~eVlVkV~aagl~~~D~~~~~g~~~~~~~~~P~i~G~e~~  151 (280)
                      ++|.+|||+++.++|.+  ++++ ++|.|.|++|||||||.++|||++|++.++|.++ ....+|.++|||++
T Consensus         1 ~~P~tMkA~v~~~~g~p--l~l~-evp~P~~~~~evlVkv~a~gic~~D~~~~~G~~~-~~~~~P~i~GhE~~   69 (175)
T d1llua1           1 TLPQTMKAAVVHAYGAP--LRIE-EVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWP-VKPPLPFIPGHEGV   69 (175)
T ss_dssp             CCCSEEEEEEBCSTTSC--CEEE-EEECCCCCTTCEEEEEEEEECCHHHHHHHHTCSS-SCCCSSBCCCSCEE
T ss_pred             CcchhcEEEEEEeCCCC--CEEE-EeECCCCCCCEEEEEEEEecCcccchhhhccCcc-ccccCCcCCCCcce
Confidence            47999999999999877  7888 9999999999999999999999999999999886 35678999999993



>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure