Citrus Sinensis ID: 023601

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MDATHPGMVPMHKVNFDAKSEYEMIQNYKVLQDVFNKLKITKHIEVNKLIKGRPLDNLEFMQWMKRYCDSVNGGLIHSYNPLERRESCKGGKEASKKSASSQSTNKGVTAAPKAQSSHNARRHDVTSVNPTTQASKTSKPSAVVPAYDEQITELKLSVDSLEKERDFYFAKLRDIEILCQSPGIEHLPIVGAIKRILYATDDDASVVAEAQAMVFHQQKEAEPLSPIAEVSEERTSSETQKRKNIVNVDVDTAGITTLSPRQRLSDVSDVHCSGSPLMTY

ccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MDATHPGMVPMHKVNFDAKSEYEMIQNYKVLQDVFNKLKITKHIEVNKLIKGRPLDNLEFMQWMKRYCDSVNGGLIHSYN********************************************************************EQITELKLSVDSLEKERDFYFAKLRDIEILCQSPGIEHLPIVGAIKRILYATDDDASVVAE***************************************D*DT*******************CSGSPLM**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDATHPGMVPMHKVNFDAKSEYEMIQNYKVLQDVFNKLKITKHIEVNKLIKGRPLDNLEFMQWMKRYCDSVNGGLIHSYNPLERRESCKGGKEASKKSASSQSTNKGVTAAPKAQSSHNARRHDVTSVNPTTQASKTSKPSAVxxxxxxxxxxxxxxxxxxxxxRDFYFAKLRDIEILCQSPGIEHLPIVGAIKRILYATDDDASVVAEAQAMVFHQQKEAEPLSPIAEVSEERTSSETQKRKNIVNVDVDTAGITTLSPRQRLSDVSDVHCSGSPLMTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Microtubule-associated protein RP/EB family member 1C	Plant-specific EB1 subtype that functions preferentially at early stages of plant mitosis by regulating spindle positioning and chromosome segregation. Accumulates in the prophase nucleus and is required to maintain spindle bipolarity during premetaphase and/or metaphase and for efficient segregation of chromosomes at anaphase. May play a role in the dynamics of microtubule network in elongating pollen tubes.	probable	Q9FGQ6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R8U, chain A
Confidence level:very confident
Coverage over the Query: 1-86
View the alignment between query and template
View the model in PyMOL