Citrus Sinensis ID: 023607

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MGNVNAREDGSNSPSGVEEGESNNSVQEEGIIVPDGLMGQSPPHSPRATHSPLMFTPQVPVVPLQRPDEMQIPNLSWMQTSSGYEDMGDGVGIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYNILDLQEYVPDDLESISSFEPPQSPETSYNNLQLTAEDFAKEPPLVPPHLQMTLLNVPASYMEIPPPLSRPQHVVLNHLYMQKGKSGPSVVALGSTHRFLAKYVTVVLYKSMQR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEECcccccEEcccccccCEEEEEEcccCEEEEEEEEccEEEEcccccCEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEcccccccEEEEEEEEEEEccEEEEEEEEEcccc

*****************************************************************************************GVGIPTMITWSHDGCEVAVEGSWDNWKTRIALQRSGKDFTIMKVLPSGVYQYRFLVDGLWKYAPDLPSTQDDDGNVYNILDLQEYVPD***************************FAKEPPLVPPHLQMTLLNVPASYMEIP**L*RPQHVVLNHLYMQKGKSGPSVVALGSTHRFLAKYVTVVLYKSMQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SNF1-related protein kinase regulatory subunit beta-2	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase.	confident	Q9SCY5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QLV, chain B
Confidence level:very confident
Coverage over the Query: 91-178
View the alignment between query and template
View the model in PyMOL