Citrus Sinensis ID: 023621

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPSSITRSSSSSSSHSPSLHSAFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
cHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEEEcccccHHHHHHccEEEEEEcccccEEEEEEEEEEccccccccccccccccccccEEEEcccccEEEEEEEEEEccccEEEEEEEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEEEEccEEEccccccccEEEEEccccccccccccccccccccccccEEEEEEEcccEEEEEcc
cHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccEEEEcccccccccHHHcccccccEEEEcEEEEEEEcEcccccccEEEEEEEcccccccccccccccccEEEEEEEEccccEEEEEEEEEcccccEEEEEEEEccccEEcEEEEEccccccccccccccEcccccccccccccccccccEccccEEccccEEEEEEEEccccccccccccccEEEEEccccccccccccccccccccccEEEEEEEEEcccEEEEcc
MQAAIAAMAHVLLVaappssshtllatlpnpssitrssssssshspslhsafhgvslkfpsrlNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLtqedgglfsftlspppppppflgfcfgqfsgEFEASILVSFfglspttvnvrvtgltpgphgfhlheygdttngcmstgahfnpnnmthgapkdevrhagdLGNIVANANGVAEATIVdnqisldgpntvVGRAFVVHELeddlgkgghelslttgnaggrlacgMHKKYLTQIICNF
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPSSITRSSSSSSSHSPSLHSAFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAvlkgtsnvEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPssitrssssssshspslhsAFHGVSLKFPSRLNLSLAAVASKKPLTvvaaakkavavLKGTSNVEGVVTLTQEDGGLFSFTLSpppppppFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
******AMAHVLLV*************************************FHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGLFS***********FLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHF***************HAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIIC**
***A***MAHVLLVAAPPSSSHTLL*********************************FPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDG**************PFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
MQAAIAAMAHVLLVAAPPSSSHTLLATLPN********************AFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
MQA*I*****VLLVAAPPSSSHTLLATLPNPSS**************L*SAFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTT*NAGGRLACGMHKKYLTQIICNF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPSSITRSSSSSSSHSPSLHSAFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGMHKKYLTQIICNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
P10792219 Superoxide dismutase [Cu- N/A no 0.684 0.872 0.646 2e-74
O78310216 Superoxide dismutase [Cu- yes no 0.670 0.865 0.655 7e-73
O65199212 Superoxide dismutase [Cu- yes no 0.641 0.844 0.656 2e-72
P14831217 Superoxide dismutase [Cu- N/A no 0.634 0.815 0.655 4e-71
O04997220 Superoxide dismutase [Cu- N/A no 0.749 0.95 0.595 5e-71
P11964202 Superoxide dismutase [Cu- N/A no 0.637 0.881 0.648 8e-71
P07505222 Superoxide dismutase [Cu- N/A no 0.763 0.959 0.584 4e-70
P93407211 Superoxide dismutase [Cu- yes no 0.523 0.691 0.702 3e-65
O65175216 Superoxide dismutase [Cu- N/A no 0.548 0.708 0.671 8e-65
O65198202 Superoxide dismutase [Cu- N/A no 0.641 0.886 0.636 8e-64
>sp|P10792|SODCP_PETHY Superoxide dismutase [Cu-Zn], chloroplastic OS=Petunia hybrida GN=SODCP PE=2 SV=1 Back     alignment and function desciption
 Score =  279 bits (713), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/232 (64%), Positives = 169/232 (72%), Gaps = 41/232 (17%)

Query: 38  SSSSSSHSPSLHSAFHGVSLKFPSRL--NLSLAAVASKKPLTVVAAAKKAVAVLKGTSNV 95
           +SS+++ +PSL S+FHGVSLK  S+   +L+L++V S KP  V AA KKAVAVLKGTSNV
Sbjct: 21  ASSNTNSAPSLSSSFHGVSLKVKSKTPQSLTLSSVTSPKPFIVFAATKKAVAVLKGTSNV 80

Query: 96  EGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVT 155
           EGVVTLTQ+D G                                       PTTV VR+T
Sbjct: 81  EGVVTLTQDDDG---------------------------------------PTTVKVRIT 101

Query: 156 GLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAE 215
           GL PG HGFHLHE+GDTTNGCMSTG HFNPN +THGAP DEVRHAGDLGNI ANA+GVAE
Sbjct: 102 GLAPGLHGFHLHEFGDTTNGCMSTGPHFNPNGLTHGAPGDEVRHAGDLGNIEANASGVAE 161

Query: 216 ATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGM 267
           AT+VDNQI L GPN+VVGRA VVHELEDDLGKGGHELSLTTGNAGGRLACG+
Sbjct: 162 ATLVDNQIPLSGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGV 213
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Petunia hybrida (taxid: 4102)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|O78310|SODC2_ARATH Superoxide dismutase [Cu-Zn] 2, chloroplastic OS=Arabidopsis thaliana GN=CSD2 PE=1 SV=2 Back     alignment and function description
>sp|O65199|SODCP_VITVI Superoxide dismutase [Cu-Zn], chloroplastic OS=Vitis vinifera GN=SODCP PE=2 SV=1 Back     alignment and function description
>sp|P14831|SODCP_SOLLC Superoxide dismutase [Cu-Zn], chloroplastic OS=Solanum lycopersicum GN=SODCP.2 PE=1 SV=1 Back     alignment and function description
>sp|O04997|SODCP_SOLCS Superoxide dismutase [Cu-Zn], chloroplastic OS=Solidago canadensis var. scabra GN=SODCP PE=2 SV=1 Back     alignment and function description
>sp|P11964|SODCP_PEA Superoxide dismutase [Cu-Zn], chloroplastic OS=Pisum sativum GN=SODCP PE=2 SV=1 Back     alignment and function description
>sp|P07505|SODCP_SPIOL Superoxide dismutase [Cu-Zn], chloroplastic OS=Spinacia oleracea GN=SODCP PE=1 SV=2 Back     alignment and function description
>sp|P93407|SODCP_ORYSJ Superoxide dismutase [Cu-Zn], chloroplastic OS=Oryza sativa subsp. japonica GN=SODCP PE=1 SV=1 Back     alignment and function description
>sp|O65175|SODCP_ZANAE Superoxide dismutase [Cu-Zn], chloroplastic OS=Zantedeschia aethiopica GN=SODCP PE=2 SV=1 Back     alignment and function description
>sp|O65198|SODCP_MEDSA Superoxide dismutase [Cu-Zn], chloroplastic OS=Medicago sativa GN=SODCP PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
74229679253 chloroplast Cu/ZnSOD [Gossypium hirsutum 0.731 0.806 0.655 1e-78
186886510214 chloroplast Cu/Zn superoxide dismutase [ 0.731 0.953 0.655 3e-78
71980140215 chloroplast Cu/Zn superoxide dismutase [ 0.720 0.934 0.663 5e-78
119351383215 chloroplast Cu/Zn superoxide dismutase [ 0.720 0.934 0.659 2e-77
381283810234 copper/zinc-superoxide dismutase 2 [Litc 0.734 0.876 0.641 4e-77
381283808223 copper/zinc-superoxide dismutase 1 [Litc 0.734 0.919 0.641 5e-77
186886512214 chloroplast Cu/Zn superoxide dismutase [ 0.731 0.953 0.651 5e-77
300381874222 chloroplast copper/zinc-superoxide dismu 0.738 0.927 0.647 4e-76
346426991228 SOD2 [Scutellaria baicalensis] 0.681 0.833 0.672 3e-75
381283804216 copper/zinc-superoxide dismutase [Prunus 0.745 0.962 0.606 1e-73
>gi|74229679|gb|ABA00454.1| chloroplast Cu/ZnSOD [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/244 (65%), Positives = 177/244 (72%), Gaps = 40/244 (16%)

Query: 24  LLATLPNPSSITRSSSSSSSHSPSLHSAFHGVSLKFPSRLNLSLAAVASKKPLTVVAAAK 83
           +  T P+  +++  SS++ S+ P L S+F GVSLK P R +LSLAA   KKP +V A  K
Sbjct: 44  IFTTTPSHLALSFPSSTNPSNPPVLLSSFRGVSLKLP-RQSLSLAATIPKKPFSVFAVTK 102

Query: 84  KAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFF 143
           KAVAVLKG S VEGVVTLTQE+ G                                    
Sbjct: 103 KAVAVLKGNSEVEGVVTLTQENDG------------------------------------ 126

Query: 144 GLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDL 203
              PTTVNVR+TGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAP+DEVRHAGDL
Sbjct: 127 ---PTTVNVRITGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPEDEVRHAGDL 183

Query: 204 GNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRL 263
           GNI+ANA+GVAEATIVDNQI L GPN VVGRAFVVHELEDDLGKGGHELSLTTGNAGGRL
Sbjct: 184 GNIIANADGVAEATIVDNQIPLSGPNAVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRL 243

Query: 264 ACGM 267
           ACG+
Sbjct: 244 ACGV 247

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|186886510|gb|ACC93637.1| chloroplast Cu/Zn superoxide dismutase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|71980140|gb|AAZ41971.1| chloroplast Cu/Zn superoxide dismutase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|119351383|gb|ABL63518.1| chloroplast Cu/Zn superoxide dismutase [Gossypium arboreum] Back     alignment and taxonomy information
>gi|381283810|gb|AFG19617.1| copper/zinc-superoxide dismutase 2 [Litchi chinensis] Back     alignment and taxonomy information
>gi|381283808|gb|AFG19616.1| copper/zinc-superoxide dismutase 1 [Litchi chinensis] Back     alignment and taxonomy information
>gi|186886512|gb|ACC93638.1| chloroplast Cu/Zn superoxide dismutase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|300381874|gb|ADG26761.2| chloroplast copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322822|gb|ADK70227.1| chloroplast copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322824|gb|ADK70228.1| chloroplast copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322826|gb|ADK70229.1| chloroplast copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322828|gb|ADK70230.1| chloroplast copper/zinc-superoxide dismutase [Dimocarpus longan] Back     alignment and taxonomy information
>gi|346426991|gb|AEO27875.1| SOD2 [Scutellaria baicalensis] Back     alignment and taxonomy information
>gi|381283804|gb|AFG19614.1| copper/zinc-superoxide dismutase [Prunus persica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2046168216 CSD2 "copper/zinc superoxide d 0.433 0.560 0.884 3.3e-67
UNIPROTKB|P93407211 SODCP "Superoxide dismutase [C 0.433 0.573 0.892 2e-59
UNIPROTKB|Q0DRV6152 SODCC1 "Superoxide dismutase [ 0.444 0.815 0.669 2.2e-43
UNIPROTKB|P28757152 SODCC2 "Superoxide dismutase [ 0.476 0.875 0.631 2.5e-42
UNIPROTKB|Q0DTX5162 Os03g0219200 "Superoxide dismu 0.430 0.740 0.675 2.5e-42
TAIR|locus:2025595152 CSD1 "copper/zinc superoxide d 0.430 0.789 0.691 6.6e-42
ZFIN|ZDB-GENE-990415-258154 sod1 "superoxide dismutase 1, 0.508 0.922 0.545 7.5e-41
UNIPROTKB|P33431153 SOD1 "Superoxide dismutase [Cu 0.433 0.790 0.603 2.8e-40
UNIPROTKB|Q8HXQ3154 SOD1 "Superoxide dismutase [Cu 0.433 0.785 0.595 5.8e-40
RGD|3731154 Sod1 "superoxide dismutase 1, 0.433 0.785 0.578 9.4e-40
TAIR|locus:2046168 CSD2 "copper/zinc superoxide dismutase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 592 (213.5 bits), Expect = 3.3e-67, Sum P(2) = 3.3e-67
 Identities = 107/121 (88%), Positives = 115/121 (95%)

Query:   147 PTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNI 206
             PTTVNVR+TGLTPGPHGFHLHE+GDTTNGC+STG HFNPNNMTHGAP+DE RHAGDLGNI
Sbjct:    90 PTTVNVRITGLTPGPHGFHLHEFGDTTNGCISTGPHFNPNNMTHGAPEDECRHAGDLGNI 149

Query:   207 VANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACG 266
              ANA+GVAE TIVDNQI L GPN+VVGRAFVVHEL+DDLGKGGHELSLTTGNAGGRLACG
Sbjct:   150 NANADGVAETTIVDNQIPLTGPNSVVGRAFVVHELKDDLGKGGHELSLTTGNAGGRLACG 209

Query:   267 M 267
             +
Sbjct:   210 V 210
GO:0004784 "superoxide dismutase activity" evidence=IEA;IDA
GO:0005507 "copper ion binding" evidence=IBA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0019430 "removal of superoxide radicals" evidence=IC;IBA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IDA
GO:0046688 "response to copper ion" evidence=IEP
GO:0009579 "thylakoid" evidence=IDA
GO:0010039 "response to iron ion" evidence=IEP
GO:0034599 "cellular response to oxidative stress" evidence=IEP
GO:0035195 "gene silencing by miRNA" evidence=IEP
GO:0071472 "cellular response to salt stress" evidence=IEP
GO:0071329 "cellular response to sucrose stimulus" evidence=IEP
GO:0048046 "apoplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009416 "response to light stimulus" evidence=IEP
GO:0071457 "cellular response to ozone" evidence=IEP
GO:0071484 "cellular response to light intensity" evidence=IEP
GO:0071493 "cellular response to UV-B" evidence=IEP
UNIPROTKB|P93407 SODCP "Superoxide dismutase [Cu-Zn], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DRV6 SODCC1 "Superoxide dismutase [Cu-Zn] 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P28757 SODCC2 "Superoxide dismutase [Cu-Zn] 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DTX5 Os03g0219200 "Superoxide dismutase [Cu-Zn]" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025595 CSD1 "copper/zinc superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-258 sod1 "superoxide dismutase 1, soluble" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P33431 SOD1 "Superoxide dismutase [Cu-Zn]" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ3 SOD1 "Superoxide dismutase [Cu-Zn]" [Hylobates lar (taxid:9580)] Back     alignment and assigned GO terms
RGD|3731 Sod1 "superoxide dismutase 1, soluble" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O78310SODC2_ARATH1, ., 1, 5, ., 1, ., 10.65500.67020.8657yesno
P93407SODCP_ORYSJ1, ., 1, 5, ., 1, ., 10.70270.52320.6919yesno
O65199SODCP_VITVI1, ., 1, 5, ., 1, ., 10.65610.64150.8443yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.946
3rd Layer1.15.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 8e-60
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 6e-57
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 4e-55
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 3e-45
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 2e-30
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 9e-14
PRK10290173 PRK10290, PRK10290, superoxide dismutase; Provisio 1e-07
PRK15388177 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Pr 9e-06
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information 
 Score =  186 bits (474), Expect = 8e-60
 Identities = 86/184 (46%), Positives = 103/184 (55%), Gaps = 41/184 (22%)

Query: 83  KKAVAVLKG-TSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVS 141
             AVAVLKG    V G VT TQ+ GG                                  
Sbjct: 1   VSAVAVLKGPDGKVVGTVTFTQQSGG---------------------------------- 26

Query: 142 FFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAG 201
                  T+   ++GLTPG HGFH+HE+GD TNGC S G HFNP    HG P DE RHAG
Sbjct: 27  ------VTITGELSGLTPGLHGFHIHEFGDCTNGCTSAGGHFNPFGKKHGGPNDEGRHAG 80

Query: 202 DLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGG 261
           DLGNIVA+ +GVA  +++D  ISL G N+++GR+ VVH  +DDLGKG  ELS  TGNAG 
Sbjct: 81  DLGNIVADKDGVATVSVLDPLISLKGGNSIIGRSLVVHAGQDDLGKGPDELSGGTGNAGV 140

Query: 262 RLAC 265
           R+AC
Sbjct: 141 RVAC 144

superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene causes familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Cytoplasmic and periplasmic SODs exist as dimers, whereas chloroplastic and extracellular enzymes exist as tetramers. Structure supports independent functional evolution in prokaryotes (P-class) and eukaryotes (E-class) [PMID:.8176730]. Length = 144
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|182357 PRK10290, PRK10290, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|185286 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
PLN02642164 copper, zinc superoxide dismutase 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
KOG4656247 consensus Copper chaperone for superoxide dismutas 99.98
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-50  Score=346.58  Aligned_cols=150  Identities=63%  Similarity=1.016  Sum_probs=144.7

Q ss_pred             eeEEEEEcCCCceEEEEEEEecCCCcccccCCCCCCCCCCCCccccccCcccccceeeeeeccccEEEEEEEecCCCCee
Q 023621           83 KKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPGPH  162 (279)
Q Consensus        83 ~~Ava~l~g~~~v~G~v~~~q~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~glvr~~~~s~v~V~v~ItGLppG~H  162 (279)
                      ++|+|+|++++.|.|+|+|+|..++                                       .++|+++|+||+||+|
T Consensus         2 ~~a~a~~~~~~~v~G~v~f~q~~~g---------------------------------------~v~i~~~~~GL~pG~h   42 (152)
T PLN02386          2 VKAVAVLNSSEGVKGTIFFTQEGDG---------------------------------------PTTVTGSLSGLKPGLH   42 (152)
T ss_pred             ceEEEEEcCCCCCEEEEEEEEcCCC---------------------------------------CEEEEEEEeCCCCCce
Confidence            5799999999889999999998777                                       5899999999999999


Q ss_pred             eEEEeccCCCCCCCCCcCccccCCCCCCCCCCCCCCCCCCCCceEEccCCeEEEEEEeceeeeCCCCCCCccEEEEecCC
Q 023621          163 GFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELE  242 (279)
Q Consensus       163 gfHIHE~GD~s~GC~SAGGHFNP~~~~HG~P~~~~rHaGDLGNI~ada~G~a~~s~~d~~lsL~G~~SIIGRSIVIHa~~  242 (279)
                      +|||||+|||+++|.|+||||||.++.||.|++..||+||||||.++++|++++++++++++|.++++|+|||||||+++
T Consensus        43 g~HIHe~Gd~~~g~~SaGgHfnP~~~~Hg~~~~~~~H~GDLgNi~~~~~G~a~~~~~~~~~~L~g~~~i~GrslVIHa~~  122 (152)
T PLN02386         43 GFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIVDKQIPLTGPNSIVGRAVVVHADP  122 (152)
T ss_pred             eEEEeCCCCCCCCcccccCccCCCCCCCCCCCcccCccccccCEEECCCCeEEEEEECCceEeCCCCccCCcEEEEEccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCcccCCCCCCeeEEEEEecc
Q 023621          243 DDLGKGGHELSLTTGNAGGRLACGMHKKY  271 (279)
Q Consensus       243 DDlg~g~~e~S~~tGnAG~RIACGVI~~~  271 (279)
                      |||++++++.|+++||+|+|||||||++.
T Consensus       123 DD~~~~~~~~s~~~G~aG~RiACgvI~~~  151 (152)
T PLN02386        123 DDLGKGGHELSKSTGNAGGRVACGIIGLQ  151 (152)
T ss_pred             CCcCCCcccccccCCCCCceEEEEEEEec
Confidence            99999999999999999999999999864

>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 1e-61
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 6e-61
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 8e-43
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 3e-40
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 2e-39
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 4e-39
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 4e-38
3gtt_A153 Mouse Sod1 Length = 153 7e-38
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 1e-37
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 1e-37
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 8e-37
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 9e-37
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 9e-37
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 9e-37
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 1e-36
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 1e-36
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 2e-36
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 2e-36
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 2e-36
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 2e-36
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 2e-36
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 2e-36
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 2e-36
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 4e-36
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 4e-36
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 5e-36
3sod_O152 Changes In Crystallographic Structure And Thermosta 5e-36
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 5e-36
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 5e-36
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 5e-36
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 5e-36
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 6e-36
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 6e-36
1cob_A151 Crystal Structure Solution And Refinement Of The Se 6e-36
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 7e-36
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 8e-36
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 8e-36
3gzo_A154 Human Sod1 G93a Variant Length = 154 8e-36
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 9e-36
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 1e-35
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-35
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 1e-35
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 1e-35
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 1e-35
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 1e-35
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-35
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 1e-35
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-35
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-35
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 1e-35
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 1e-35
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 1e-35
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 2e-35
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 2e-35
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 2e-35
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 2e-35
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-35
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 2e-35
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 2e-35
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 3e-35
3h2p_A153 Human Sod1 D124v Variant Length = 153 3e-35
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 4e-35
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 4e-35
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 4e-35
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 5e-35
3gqf_A153 Structural And Biophysical Properties Of The Pathog 6e-35
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 6e-35
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 1e-34
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 2e-34
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 2e-34
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 3e-34
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 3e-34
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 6e-34
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 6e-34
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 2e-33
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 3e-33
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 1e-32
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 7e-32
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 4e-31
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 5e-31
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 4e-18
1xtm_B175 Crystal Structure Of The Double Mutant Y88h-p104h O 6e-09
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 2e-08
1xtl_B175 Crystal Structure Of P104h Mutant Of Sod-Like Prote 2e-08
2wwn_A169 Yersinia Pseudotuberculosis Superoxide Dismutase C 6e-08
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 2e-07
1s4i_B175 Crystal Structure Of A Sod-like Protein From Bacill 3e-07
1u3n_A162 A Sod-Like Protein From B. Subtilis, Unstructured I 3e-07
1oal_A151 Active Site Copper And Zinc Ions Modulate The Quate 5e-07
1ibd_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 7e-07
1ibh_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 7e-07
1bzo_A151 Three-Dimensional Structure Of Prokaryotic Cu,Zn Su 7e-07
1yai_A151 X-Ray Structure Of A Bacterial Copper,Zinc Superoxi 7e-07
1ibf_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 8e-07
1ib5_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 8e-07
1oaj_A151 Active Site Copper And Zinc Ions Modulate The Quate 9e-07
1ibb_A151 X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant 1e-06
2aqm_A154 CuZN SUPEROXIDE DISMUTASE FROM BRUCELLA ABORTUS Len 2e-06
1eqw_A156 Crystal Structure Of Salmonella Typhimurium Cu,Zn S 1e-05
1eso_A154 Monomeric Cu,Zn Superoxide Dismutase From Escherich 3e-05
1pzs_A208 Crystal Structure Of A Cu-Zn Superoxide Dismutase F 2e-04
2k4w_A154 The Solution Structure Of The Monomeric Copper, Zin 4e-04
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure 
Iteration: 1

 Score =  233 bits (593), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/179 (67%), Positives = 130/179 (72%), Gaps = 39/179 (21%)
Query: 89  LKGTSNVEGVVTLTQEDGGLFSFTLSXXXXXXXFLGFCFGQFSGEFEASILVSFFGLSPT 148
           LKG SNVEGVVTL+Q+D G                                       PT
Sbjct: 9   LKGNSNVEGVVTLSQDDDG---------------------------------------PT 29
Query: 149 TVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVA 208
           TVNVR+TGL PG HGFHLHEYGDTTNGCMSTGAHFNPN +THGAP DE+RHAGDLGNIVA
Sbjct: 30  TVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVA 89
Query: 209 NANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGM 267
           NA+GVAE T+VDNQI L GPN+VVGRA VVHELEDDLGKGGHELSLTTGNAGGRLACG+
Sbjct: 90  NADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGV 148
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|1XTM|B Chain B, Crystal Structure Of The Double Mutant Y88h-p104h Of A Sod-like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|1XTL|B Chain B, Crystal Structure Of P104h Mutant Of Sod-Like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|2WWN|A Chain A, Yersinia Pseudotuberculosis Superoxide Dismutase C With Bound Azide Length = 169 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|1S4I|B Chain B, Crystal Structure Of A Sod-like Protein From Bacillus Subtilis Length = 175 Back     alignment and structure
>pdb|1U3N|A Chain A, A Sod-Like Protein From B. Subtilis, Unstructured In Solution, Becomes Ordered In The Crystal: Implications For Function And For Fibrillogenesis Length = 162 Back     alignment and structure
>pdb|1OAL|A Chain A, Active Site Copper And Zinc Ions Modulate The Quaternary Structure Of Prokaryotic Cu,Zn Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1IBD|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant V29a Length = 151 Back     alignment and structure
>pdb|1IBH|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant M41i Length = 151 Back     alignment and structure
>pdb|1BZO|A Chain A, Three-Dimensional Structure Of Prokaryotic Cu,Zn Superoxide Dismutase From P.Leiognathi, Solved By X-Ray Crystallography Length = 151 Back     alignment and structure
>pdb|1YAI|A Chain A, X-Ray Structure Of A Bacterial Copper,Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1IBF|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant V29g Length = 151 Back     alignment and structure
>pdb|1IB5|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant W83y Length = 151 Back     alignment and structure
>pdb|1OAJ|A Chain A, Active Site Copper And Zinc Ions Modulate The Quaternary Structure Of Prokaryotic Cu,Zn Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1IBB|A Chain A, X-Ray 3d Structure Of P.Leiognathi Cu,Zn Sod Mutant W83f Length = 151 Back     alignment and structure
>pdb|2AQM|A Chain A, CuZN SUPEROXIDE DISMUTASE FROM BRUCELLA ABORTUS Length = 154 Back     alignment and structure
>pdb|1EQW|A Chain A, Crystal Structure Of Salmonella Typhimurium Cu,Zn Superoxide Dismutase Length = 156 Back     alignment and structure
>pdb|1ESO|A Chain A, Monomeric Cu,Zn Superoxide Dismutase From Escherichia Coli Length = 154 Back     alignment and structure
>pdb|1PZS|A Chain A, Crystal Structure Of A Cu-Zn Superoxide Dismutase From Mycobacterium Tuberculosis At 1.63 Resolution Length = 208 Back     alignment and structure
>pdb|2K4W|A Chain A, The Solution Structure Of The Monomeric Copper, Zinc Superox Dismutase From Salmonella Enterica Length = 154 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 7e-72
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 8e-72
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 2e-71
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 4e-71
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 1e-69
1do5_A154 Human copper chaperone for superoxide dismutase do 2e-69
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 2e-68
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 2e-68
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 3e-68
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 7e-68
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 2e-66
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 2e-65
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 4e-58
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 7e-56
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 7e-56
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 1e-55
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 5e-54
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 8e-54
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 2e-52
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 9e-52
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 2e-48
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 3e-37
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 1e-34
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 5e-34
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
 Score =  216 bits (553), Expect = 7e-72
 Identities = 87/187 (46%), Positives = 107/187 (57%), Gaps = 38/187 (20%)

Query: 80  AAAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASIL 139
            +  KAV V+ GT+ V+GVV  TQE                                   
Sbjct: 1   GSNMKAVCVMTGTAGVKGVVKFTQETDN-------------------------------- 28

Query: 140 VSFFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRH 199
                  P  V+   +GL  G HGFH+HE+GDTTNGC S GAHFNP    HGAP+D +RH
Sbjct: 29  ------GPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRH 82

Query: 200 AGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNA 259
            GDLGN+VA A+G A     D  ISL+G ++++GR+ V+HE EDDLG+GGHELS  TGNA
Sbjct: 83  VGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNA 142

Query: 260 GGRLACG 266
           GGRLACG
Sbjct: 143 GGRLACG 149
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
Probab=100.00  E-value=3.5e-54  Score=368.13  Aligned_cols=152  Identities=84%  Similarity=1.296  Sum_probs=147.2

Q ss_pred             cceeEEEEEcCCCceEEEEEEEecCCCcccccCCCCCCCCCCCCccccccCcccccceeeeeeccccEEEEEEEecCCCC
Q 023621           81 AAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPG  160 (279)
Q Consensus        81 ~~~~Ava~l~g~~~v~G~v~~~q~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~glvr~~~~s~v~V~v~ItGLppG  160 (279)
                      ++++|||+|+|.++|+|+|+|+|..++                                       .|+|+++|+||+||
T Consensus         1 ~~~~Avavl~g~~~V~G~v~f~q~~~g---------------------------------------~v~v~~~i~GL~pG   41 (154)
T 3pu7_A            1 ATKKAVAVLKGNSNVEGVVTLSQDDDG---------------------------------------PTTVNVRITGLAPG   41 (154)
T ss_dssp             CEEEEEEEEBCSSSCEEEEEEEEETTS---------------------------------------CEEEEEEEESCCSE
T ss_pred             CCceEEEEECCCCCCEEEEEEEEeCCC---------------------------------------cEEEEEEEECCCCC
Confidence            367999999999999999999999877                                       58999999999999


Q ss_pred             eeeEEEeccCCCCCCCCCcCccccCCCCCCCCCCCCCCCCCCCCceEEccCCeEEEEEEeceeeeCCCCCCCccEEEEec
Q 023621          161 PHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHE  240 (279)
Q Consensus       161 ~HgfHIHE~GD~s~GC~SAGGHFNP~~~~HG~P~~~~rHaGDLGNI~ada~G~a~~s~~d~~lsL~G~~SIIGRSIVIHa  240 (279)
                      .|+|||||+|||+++|.|||+||||+++.||.|+++.||+||||||+++++|+++++|+|++|+|+|+++|+|||||||+
T Consensus        42 ~hgfHIHe~Gd~s~gc~SaGgHfnP~~~~Hg~p~~~~~h~GDLgni~~~~~G~a~~~~~d~~l~L~g~~~iiGRslVIH~  121 (154)
T 3pu7_A           42 LHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHE  121 (154)
T ss_dssp             EEEEEEESCCCCTTGGGGGCSBCCTTCCCCCCTTCSSCCTTEEEEEEECTTSCEEEEEEESSCCSSSTTCCTTSEEEEES
T ss_pred             cccEEEeecCCCCCCccccccccCCccCcCCCCCccCCcCCcccCEEeCCCCcEEEEEEeCCeeeCCCCccCCeEEEEEC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCcccCCCCCCeeEEEEEecc
Q 023621          241 LEDDLGKGGHELSLTTGNAGGRLACGMHKKY  271 (279)
Q Consensus       241 ~~DDlg~g~~e~S~~tGnAG~RIACGVI~~~  271 (279)
                      ++|||++++||.|+++||+|+|||||||+++
T Consensus       122 ~~DD~~~g~~~~s~~tGnaG~RiaCGvIg~~  152 (154)
T 3pu7_A          122 LEDDLGKGGHELSLTTGNAGGRLACGVVGLT  152 (154)
T ss_dssp             SCCCTTCSCCTTTTTTTTCCCEEEEEECEEC
T ss_pred             CCccCCCCCCcCCcCCCCCcCcEEEEEEEEe
Confidence            9999999999999999999999999999986
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 8e-51
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 3e-50
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 6e-49
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 1e-48
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-45
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 3e-44
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 6e-37
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 4e-36
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 4e-36
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 1e-35
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 7e-35
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-31
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  162 bits (410), Expect = 8e-51
 Identities = 82/185 (44%), Positives = 101/185 (54%), Gaps = 38/185 (20%)

Query: 82  AKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVS 141
           A KAV VLKG   V+G++   Q++                                    
Sbjct: 1   ATKAVCVLKGDGPVQGIINFEQKESN---------------------------------- 26

Query: 142 FFGLSPTTVNVRVTGLTPGPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAG 201
                P  V   + GLT G HGFH+HE+GD T GC S G HFNP +  HG PKDE RH G
Sbjct: 27  ----GPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVG 82

Query: 202 DLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGG 261
           DLGN+ A+ +GVA+ +I D+ ISL G + ++GR  VVHE  DDLGKGG+E S  TGNAG 
Sbjct: 83  DLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGS 142

Query: 262 RLACG 266
           RLACG
Sbjct: 143 RLACG 147
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 100.0
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Spinach (Spinacia oleracea) [TaxId: 3562]

Probab=100.00  E-value=4.7e-52  Score=351.80  Aligned_cols=153  Identities=84%  Similarity=1.265  Sum_probs=148.1

Q ss_pred             cceeEEEEEcCCCceEEEEEEEecCCCcccccCCCCCCCCCCCCccccccCcccccceeeeeeccccEEEEEEEecCCCC
Q 023621           81 AAKKAVAVLKGTSNVEGVVTLTQEDGGLFSFTLSPPPPPPPFLGFCFGQFSGEFEASILVSFFGLSPTTVNVRVTGLTPG  160 (279)
Q Consensus        81 ~~~~Ava~l~g~~~v~G~v~~~q~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~glvr~~~~s~v~V~v~ItGLppG  160 (279)
                      |.|+|||+|||+++|+|+|+|+|..+|                                       +|+|+++|+||+||
T Consensus         1 ~~~~Ava~~~g~~~v~G~v~f~q~~~g---------------------------------------~v~v~v~l~GL~pG   41 (154)
T d1srda_           1 ATKKAVAVLKGTSNVEGVVTLTQEDDG---------------------------------------PTTVNVRISGLAPG   41 (154)
T ss_dssp             CEEEEEEECBCSSSCCCEEEEEEETTS---------------------------------------CEEEEEEEESCCSE
T ss_pred             CCcEEEEEEcCCCCcEEEEEEEECCCC---------------------------------------cEEEEEEEecCCCC
Confidence            568999999999899999999999888                                       58999999999999


Q ss_pred             eeeEEEeccCCCCCCCCCcCccccCCCCCCCCCCCCCCCCCCCCceEEccCCeEEEEEEeceeeeCCCCCCCccEEEEec
Q 023621          161 PHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIVDNQISLDGPNTVVGRAFVVHE  240 (279)
Q Consensus       161 ~HgfHIHE~GD~s~GC~SAGGHFNP~~~~HG~P~~~~rHaGDLGNI~ada~G~a~~s~~d~~lsL~G~~SIIGRSIVIHa  240 (279)
                      .|+|||||+|||+++|.++|+||||.+..|+.|++..+|+||||||.++++|+++++|+|++++|+++++|+|||||||+
T Consensus        42 ~hg~HIHe~Gd~~~~~~saGgh~np~~~~hg~~~~~~~h~GDLgni~~~~~G~~~~~~~~~~l~L~g~~~iiGRSivIH~  121 (154)
T d1srda_          42 KHGFHLHEFGDTTNGCMSTGPHFNPDKKTHGAPEDEVRHAGDLGNIVANTDGVAEATIVDNQIPLTGPNSVVGRALVVHE  121 (154)
T ss_dssp             ECCEEEESCCCCTTGGGGGCSBCCTTCCCCCCSSCSSCCSSBCCCCEECTTSEEEEEEEESSCCSSSTTCCTTCEEEEES
T ss_pred             ceeEEEecCCccCCCccccccccccccccccCCCccccccccccCeEECCCCeEEEEEEeCcEEeCCCCCCCCcEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCcccCCCCCCeeEEEEEeccc
Q 023621          241 LEDDLGKGGHELSLTTGNAGGRLACGMHKKYL  272 (279)
Q Consensus       241 ~~DDlg~g~~e~S~~tGnAG~RIACGVI~~~~  272 (279)
                      ++|||++++++.|+++||+|+|||||||++++
T Consensus       122 ~~Dd~~~~~~~~s~~~g~aG~RiACgvI~~~~  153 (154)
T d1srda_         122 LEDDLGKGGHELSPTTGNAGGRLACGVVGLTP  153 (154)
T ss_dssp             SCCCTTCSCSSSTTTTCSCCCEEEEEECEEEC
T ss_pred             CCcccCCCCcccCcccCCCCceEEEEEEEeec
Confidence            99999999999999999999999999999865
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure