Citrus Sinensis ID: 023623

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MNSGELGLENFFKKVQDIDKEYEKLEKLLKKLQGAHEESKSVTKAPAMKAIKKRMEKDVDEVGKISRFIKSKIEELDRENLTSRQKPGCGKGTGVDRSRTATTLGLKKKFKDKMGEFQVLRENIHQEYREVVERRVYTVTGKRADEETIDQLIETGDSEQIFQKAIQEQGRGQIMDTLAEIQERHDAVRDLERKLLELQQIFLDMAVLVDAQGDMLDNIESQVSSAVDHVQSGNTALQKAKKLQKNSRKWMCIAIIILLIIVAIIVVAVIKPWSSNKGA

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccc

****ELG**NFFKKVQDIDKEYEKLEKLLKKLQ***************************EVGKISRFIKSKI***************************ATTLGLKKKFKDKMGEFQVLRENIHQEYREVVERRVYTVTGKRADEETIDQLIE******IFQKAI******QIMDTLAEIQERHDAVRDLERKLLELQQIFLDMAVLVDAQGDMLDNIESQVSSAVDHVQSGNTALQKAKKLQKNSRKWMCIAIIILLIIVAIIVVAVIKPWS*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx

MNSGELGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTKAPAMKAIKKRMEKDVDEVGKISRFIKSKIEELDRENLTSRQKPGCGKGTGVDRSRTATTLGLKKKFKDKMGEFQVLRENIHQEYREVVERRVYTVTGKRADEETIDQLIETGDSEQIFQKAIQEQGRGQIMDTLAExxxxxxxxxxxxxxxxxxxxxFLDMAVLVDAQGDMLDNIESQVSSAVDHVQSGNTALQKAKKLQKNSRKWMCIAIIILLIIVAIIVVAVIKPWSSNKGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative syntaxin-131	Vesicle trafficking protein that functions in the secretory pathway.	confident	Q9SRV7
Syntaxin-132	Vesicle trafficking protein that functions in the secretory pathway.	probable	Q8VZU2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHE, chain B
Confidence level:very confident
Coverage over the Query: 3-156,179-230
View the alignment between query and template
View the model in PyMOL

Template: 3HD7, chain B
Confidence level:very confident
Coverage over the Query: 175-269
View the alignment between query and template
View the model in PyMOL