Citrus Sinensis ID: 023674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MGNSGSHRRHHSNIPPPTPPPTTRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD
cccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEECcccEEEECccccccCEEEEEEEEcccccEEEEEEcccccccccEEEcccccccccEEEECccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccEEEEccccccccHHHHHHHHcccccccccccHHccEEEEEccccccc
*****************************YVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPS********************KAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNSGSHRRHHSNIPPPTPPPTTRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable E3 ubiquitin-protein ligase LUL2 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).probableQ9LFH6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y1N, chain A
Confidence level:very confident
Coverage over the Query: 108-205,216-274
View the alignment between query and template
View the model in PyMOL
Template: 4AF8, chain A
Confidence level:probable
Coverage over the Query: 18-156
View the alignment between query and template
View the model in PyMOL