Citrus Sinensis ID: 023674


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MGNSGSHRRHHSNIPPPTPPPTTRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD
cccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEcccEEEEEccccccEEEEEEEEEcccccEEEEEEcccccccccEEEcccccccccEEEEEccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccEEEEccccccccHHHHHHHHccccccccccHHHccEEEEEccccccc
cccccHHHHcccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEcccEEEEEccccccccEEEEEEEEccccEEEEEEEEEEEccccEEEccccccccccEEEcccccccEEEccccccccHHHHHcccHEEEEEEEcccEEEEEEEEcEEccccccccccccEEEEEEcccccEEEEccccHHccHHHHHHHHHHHccccccccHHHHHHEEEEcccccc
mgnsgshrrhhsnippptpppttrqtqsQYVFAaatpypsqypnqyyplypgyypppvpvhgaygyhhmpsghypahppppppppqymehqkavtirndvnvkketlrvepdeenpgqflvaftfdaaapgsitvaffgkedvdcTLIATKEELLKPVTITFqqglgqkfrqpcgtgidlsmfdEIALTKQILWVNRVRYELQEIYGigstvagdetdsgkecviclseprdttvlpcrhmcmcseCAKVLQfqtnrcpicrqPVERLLEIKVNNAADD
mgnsgshrrhhsnippptpppttRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETlrvepdeenpGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIgstvagdetdsGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPverlleikvnnaadd
MGNSGSHRRHHSNIppptpppttRQTQSQYVFAAATpypsqypnqyyplypgyypppvpvhgaygyHHMPSGHYPAHppppppppQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD
*****************************YVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHH*************************************************QFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKV******
*****************************YVFAA*****************************YGYHHMPS********************KAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQE***************GKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEI*VN*****
*************IPPP*********QSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD
***************PPTPPPTTRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNSGSHRRHHSNIPPPTPPPTTRQTQSQYVFAAATPYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIALTKQILWVNRVRYELQEIYGIGSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNNAADD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q9LFH6299 Probable E3 ubiquitin-pro yes no 0.795 0.742 0.520 1e-73
Q9LYW5337 Probable E3 ubiquitin-pro no no 0.942 0.780 0.490 1e-72
Q9S752388 Probable E3 ubiquitin-pro no no 0.709 0.510 0.522 5e-68
Q84ME1378 Probable E3 ubiquitin-pro no no 0.827 0.611 0.403 1e-55
Q8LA32359 Probable E3 ubiquitin-pro no no 0.688 0.534 0.434 6e-53
Q96PX1 679 RING finger protein 157 O yes no 0.709 0.291 0.324 9e-26
Q3TEL6 685 RING finger protein 157 O yes no 0.709 0.289 0.320 4e-25
Q5XIQ4 533 E3 ubiquitin-protein liga no no 0.655 0.343 0.305 4e-24
Q9D074 532 E3 ubiquitin-protein liga no no 0.706 0.370 0.3 6e-24
O60291 552 E3 ubiquitin-protein liga no no 0.655 0.331 0.301 8e-24
>sp|Q9LFH6|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana GN=LUL2 PE=2 SV=1 Back     alignment and function desciption
 Score =  276 bits (705), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 174/292 (59%), Gaps = 70/292 (23%)

Query: 37  PYPSQYPNQYYPLYPGYYPPPVPVHGAYGYHHMPSGHYPAHPPPPPPPPQYMEHQKAVTI 96
           PYP+  PN     Y G YP P      Y Y  M S            P QY+EHQ+AVTI
Sbjct: 21  PYPN--PN---AQYQGNYPSPYQDCARYPYGEMAS------------PVQYVEHQEAVTI 63

Query: 97  RNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGKEDVDCTLIATKEELLK 156
           RND+N+KKETLR+EPDE+NPG+FL++FTFDA+ PGSITV FF KE  DC LIATKE+L  
Sbjct: 64  RNDINLKKETLRLEPDEQNPGKFLLSFTFDASVPGSITVMFFAKEGKDCNLIATKEDLFP 123

Query: 157 PVTITFQQGLGQKFRQPCGTGIDLSMFDEIAL---------------------------- 188
              ++F +GL Q+F+Q CGTGID S   E  L                            
Sbjct: 124 STQVSFAKGLEQRFKQACGTGIDFSDMSEADLVEANETDVYHVAVKAEVVSEDDHPESGT 183

Query: 189 ----------------------TKQILWVNRVRYELQEIYGIGSTV---AGDETDSGKEC 223
                                  KQILWVN  RY LQEIYGIG+TV     D  + GKEC
Sbjct: 184 PNRQITHVVLEKDHKGEYKARVVKQILWVNGNRYVLQEIYGIGNTVDDNGEDANERGKEC 243

Query: 224 VICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNN 275
           VICLSEPRDTTVLPCRHMCMCS CAK+L+FQTN CPICRQPV+RLLEI VNN
Sbjct: 244 VICLSEPRDTTVLPCRHMCMCSGCAKLLRFQTNLCPICRQPVDRLLEITVNN 295




Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9LYW5|LUL1_ARATH Probable E3 ubiquitin-protein ligase LUL1 OS=Arabidopsis thaliana GN=LUL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9S752|LOFG2_ARATH Probable E3 ubiquitin-protein ligase LOG2 OS=Arabidopsis thaliana GN=LOG2 PE=1 SV=1 Back     alignment and function description
>sp|Q84ME1|LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana GN=LUL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8LA32|LUL4_ARATH Probable E3 ubiquitin-protein ligase LUL4 OS=Arabidopsis thaliana GN=LUL4 PE=2 SV=1 Back     alignment and function description
>sp|Q96PX1|RN157_HUMAN RING finger protein 157 OS=Homo sapiens GN=RNF157 PE=1 SV=3 Back     alignment and function description
>sp|Q3TEL6|RN157_MOUSE RING finger protein 157 OS=Mus musculus GN=Rnf157 PE=2 SV=2 Back     alignment and function description
>sp|Q5XIQ4|MGRN1_RAT E3 ubiquitin-protein ligase MGRN1 OS=Rattus norvegicus GN=Mgrn1 PE=2 SV=1 Back     alignment and function description
>sp|Q9D074|MGRN1_MOUSE E3 ubiquitin-protein ligase MGRN1 OS=Mus musculus GN=Mgrn1 PE=1 SV=2 Back     alignment and function description
>sp|O60291|MGRN1_HUMAN E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens GN=MGRN1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
297746246 383 unnamed protein product [Vitis vinifera] 0.942 0.686 0.562 6e-83
225435295349 PREDICTED: E3 ubiquitin-protein ligase M 0.942 0.753 0.559 1e-82
108707230 430 zinc finger family protein, putative, ex 0.896 0.581 0.518 4e-82
218184262 425 hypothetical protein OsI_32999 [Oryza sa 0.691 0.454 0.593 4e-77
115481426 425 Os10g0204100 [Oryza sativa Japonica Grou 0.691 0.454 0.593 5e-77
225439970362 PREDICTED: E3 ubiquitin-protein ligase M 0.881 0.679 0.526 5e-77
297833744 385 hypothetical protein ARALYDRAFT_478299 [ 0.727 0.527 0.556 2e-74
297600676290 Os03g0254900 [Oryza sativa Japonica Grou 0.702 0.675 0.566 6e-74
449440089368 PREDICTED: probable E3 ubiquitin-protein 0.881 0.668 0.483 2e-73
224140185283 predicted protein [Populus trichocarpa] 0.741 0.731 0.555 5e-72
>gi|297746246|emb|CBI16302.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  313 bits (802), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 208/327 (63%), Gaps = 64/327 (19%)

Query: 16  PPTPPPTTRQTQSQYVFAAATPYPSQYPNQ---YYPLYPGYYPP-PVPVHGAYGYHHMPS 71
           PP   P    T ++YVFAAAT Y S YPN    YY  Y G+YPP PVP+ G+Y   H   
Sbjct: 56  PPQLSPQPEITANRYVFAAATAYTSAYPNPNQPYYYNYNGHYPPVPVPLSGSYTRLHRAG 115

Query: 72  GHYP----AHPP---PPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFT 124
           G  P     H P    PPPP  Y+EHQKA+TIRNDVN+KKETLRVEPDEENPG+FLVAFT
Sbjct: 116 GAIPNWVGGHQPCGVAPPPPAPYVEHQKAITIRNDVNIKKETLRVEPDEENPGKFLVAFT 175

Query: 125 FDAAAPGSITVAFFGKEDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFD 184
           FDA A GSITV FFGKE +   LI  KE +++PVT++FQQGL QKF+QP GTGID SMF+
Sbjct: 176 FDATAAGSITVVFFGKEGISGDLITVKEGVIEPVTVSFQQGLDQKFKQPSGTGIDFSMFE 235

Query: 185 EIAL---------------------------------------------------TKQIL 193
           E  L                                                    KQIL
Sbjct: 236 ETELMQESDIKVCPLLVKAGAYPLDHSQSEGNLTGNSQITQAVFEKEKGVQQVRVVKQIL 295

Query: 194 WVNRVRYELQEIYGIGSTV--AGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVL 251
           W   +RYELQEI+GIG++V    D TDSGKECVICLSEPRDTTVLPCRHMCMC  CAKVL
Sbjct: 296 WAEGMRYELQEIFGIGNSVDDNADGTDSGKECVICLSEPRDTTVLPCRHMCMCGGCAKVL 355

Query: 252 QFQTNRCPICRQPVERLLEIKVNNAAD 278
           +FQ NRCPICRQPVE+LLEIKVNN +D
Sbjct: 356 RFQMNRCPICRQPVEQLLEIKVNNKSD 382




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435295|ref|XP_002285111.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|108707230|gb|ABF95025.1| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|215712342|dbj|BAG94469.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218184262|gb|EEC66689.1| hypothetical protein OsI_32999 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115481426|ref|NP_001064306.1| Os10g0204100 [Oryza sativa Japonica Group] gi|19225030|gb|AAL86506.1|AC099040_10 putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica Group] gi|20279471|gb|AAM18751.1|AC099325_7 unknown protein [Oryza sativa Japonica Group] gi|31430853|gb|AAP52712.1| RING zinc finger protein, putative, expressed [Oryza sativa Japonica Group] gi|113638915|dbj|BAF26220.1| Os10g0204100 [Oryza sativa Japonica Group] gi|222612586|gb|EEE50718.1| hypothetical protein OsJ_31005 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225439970|ref|XP_002280999.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297833744|ref|XP_002884754.1| hypothetical protein ARALYDRAFT_478299 [Arabidopsis lyrata subsp. lyrata] gi|297330594|gb|EFH61013.1| hypothetical protein ARALYDRAFT_478299 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297600676|ref|NP_001049589.2| Os03g0254900 [Oryza sativa Japonica Group] gi|125583739|gb|EAZ24670.1| hypothetical protein OsJ_08439 [Oryza sativa Japonica Group] gi|255674380|dbj|BAF11503.2| Os03g0254900 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449440089|ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] gi|449513666|ref|XP_004164388.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224140185|ref|XP_002323465.1| predicted protein [Populus trichocarpa] gi|222868095|gb|EEF05226.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2075069388 LOG2 "LOSS OF GDU 2" [Arabidop 0.333 0.239 0.772 1.8e-74
TAIR|locus:2084026299 LUL2 "LOG2-LIKE UBIQUITIN LIGA 0.315 0.294 0.769 8.6e-71
TAIR|locus:2143493337 LUL1 "LOG2-LIKE UBIQUITIN LIGA 0.315 0.261 0.744 4.8e-66
TAIR|locus:2082440359 LUL4 "LOG2-LIKE UBIQUITIN LIGA 0.483 0.376 0.471 6.9e-31
TAIR|locus:2179594378 LUL3 "LOG2-LIKE UBIQUITIN LIGA 0.526 0.388 0.413 3e-30
UNIPROTKB|K7EIM7332 MGRN1 "E3 ubiquitin-protein li 0.290 0.243 0.522 4.1e-28
UNIPROTKB|E1C804 536 MGRN1 "Uncharacterized protein 0.290 0.151 0.522 5.4e-28
FB|FBgn0030514 789 CG9941 [Drosophila melanogaste 0.297 0.105 0.516 3.2e-27
RGD|1311862 533 Mgrn1 "mahogunin ring finger 1 0.290 0.151 0.522 3.6e-27
UNIPROTKB|Q5XIQ4 533 Mgrn1 "E3 ubiquitin-protein li 0.290 0.151 0.522 3.6e-27
TAIR|locus:2075069 LOG2 "LOSS OF GDU 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 401 (146.2 bits), Expect = 1.8e-74, Sum P(2) = 1.8e-74
 Identities = 78/101 (77%), Positives = 84/101 (83%)

Query:   185 EIALTKQILWVNRVRYELQEIYGIGSTVAGDE------TDSGKECVICLSEPRDTTVLPC 238
             +I + KQILWVN  RYELQEIYGIG+TV GD+       D GKECVICLSEPRDTTVLPC
Sbjct:   275 KIRVVKQILWVNGTRYELQEIYGIGNTVEGDDDSADDANDPGKECVICLSEPRDTTVLPC 334

Query:   239 RHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKV--NNAA 277
             RHMCMCS CAKVL+FQTNRCPICRQPVERLLEIKV  NN +
Sbjct:   335 RHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNNGS 375


GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0080144 "amino acid homeostasis" evidence=IGI
TAIR|locus:2084026 LUL2 "LOG2-LIKE UBIQUITIN LIGASE2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143493 LUL1 "LOG2-LIKE UBIQUITIN LIGASE1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082440 LUL4 "LOG2-LIKE UBIQUITIN LIGASE4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179594 LUL3 "LOG2-LIKE UBIQUITIN LIGASE3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|K7EIM7 MGRN1 "E3 ubiquitin-protein ligase MGRN1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C804 MGRN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0030514 CG9941 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1311862 Mgrn1 "mahogunin ring finger 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XIQ4 Mgrn1 "E3 ubiquitin-protein ligase MGRN1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LFH6LUL2_ARATH6, ., 3, ., 2, ., -0.52050.79560.7424yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024522001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (349 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-17
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-08
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-08
smart0018440 smart00184, RING, Ring finger 4e-05
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.001
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.004
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
 Score = 74.0 bits (182), Expect = 2e-17
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 219 SGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVER 267
               CVICL  PR+   LPC H+C+C ECAK L+    +CPICRQP+E 
Sbjct: 1   EDDLCVICLERPRNVVFLPCGHLCLCEECAKRLR-SKKKCPICRQPIES 48


Length = 49

>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 99.71
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.43
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.42
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.0
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.92
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.92
PHA02929238 N1R/p28-like protein; Provisional 98.91
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.81
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.71
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.63
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.62
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.58
PHA02926242 zinc finger-like protein; Provisional 98.57
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.5
PF1463444 zf-RING_5: zinc-RING finger domain 98.5
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.48
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.44
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.42
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.42
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.42
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.39
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.34
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.3
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.29
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.15
COG5236 493 Uncharacterized conserved protein, contains RING Z 98.14
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.06
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.91
PF0276286 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do 97.89
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.87
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.85
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.81
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.72
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.7
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.49
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.43
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.31
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.31
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.08
COG5152259 Uncharacterized conserved protein, contains RING a 97.06
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.87
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.78
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.53
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.2
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.13
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.09
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.89
KOG4445 368 consensus Uncharacterized conserved protein, conta 95.85
COG52191525 Uncharacterized conserved protein, contains RING Z 95.7
PF04641260 Rtf2: Rtf2 RING-finger 95.68
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.66
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.43
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.38
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.31
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.97
KOG2660 331 consensus Locus-specific chromosome binding protei 94.87
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.81
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.6
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.48
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.41
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.29
PHA02825162 LAP/PHD finger-like protein; Provisional 94.14
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.09
KOG4739 233 consensus Uncharacterized protein involved in syna 94.02
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.01
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.9
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.41
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.85
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 92.85
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 92.72
KOG3002 299 consensus Zn finger protein [General function pred 92.6
KOG2113394 consensus Predicted RNA binding protein, contains 92.53
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 92.28
PF10272358 Tmpp129: Putative transmembrane protein precursor; 92.19
PHA02862156 5L protein; Provisional 91.91
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 91.44
PHA03096284 p28-like protein; Provisional 91.4
KOG149384 consensus Anaphase-promoting complex (APC), subuni 89.99
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 89.49
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 88.98
COG5222427 Uncharacterized conserved protein, contains RING Z 88.92
KOG1941518 consensus Acetylcholine receptor-associated protei 88.84
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 88.81
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.65
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 88.05
KOG3842429 consensus Adaptor protein Pellino [Signal transduc 87.14
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 86.89
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 85.92
KOG2113 394 consensus Predicted RNA binding protein, contains 85.18
KOG3799169 consensus Rab3 effector RIM1 and related proteins, 84.94
KOG3053 293 consensus Uncharacterized conserved protein [Funct 83.61
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 83.12
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 81.93
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 80.39
KOG0825 1134 consensus PHD Zn-finger protein [General function 80.07
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=7.4e-52  Score=379.63  Aligned_cols=275  Identities=48%  Similarity=0.793  Sum_probs=213.5

Q ss_pred             CCCCCCCC----CCCCCCCCCCCC-CCCCCCCcccc-ccCCCCCCCCCCCCCCCCCCC-CCCCCCCCC--CCCCC---CC
Q 023674            1 MGNSGSHR----RHHSNIPPPTPP-PTTRQTQSQYV-FAAATPYPSQYPNQYYPLYPG-YYPPPVPVH--GAYGY---HH   68 (279)
Q Consensus         1 ~~~~~s~~----~~~~~~~ppppp-p~p~~~~~~~~-~~~~~p~p~p~p~~~~~~~~~-~~ppppp~p--~p~~~---~~   68 (279)
                      |||+.|.+    +|+..++.+|+. ..++++++.++ |..+.||+++.+. .+-.+.+ +.++.-..|  .||+.   +|
T Consensus         1 MG~v~s~~~~~~~~~~~~~~~p~~~~~~p~~~n~~~~F~~~~p~~~~~~~-~~l~~~~~~~~~~~~rp~~~Py~~~~~~h   79 (349)
T KOG4265|consen    1 MGNVLSRGFNGVSRLLSHANVPPAYYTPPPSGNYFGHFGMGGPYDNPNPE-EYLFYLNNLLPFLGSRPVLFPYYFTPLSH   79 (349)
T ss_pred             CceeeecccccccccccccCCCcccccCCCCCCeeeeEeccCCCCCCChh-hhcccccccccccccccccCCCCCCCccc
Confidence            99999972    333333322111 11223356666 7777788888776 2223333 222111111  11221   11


Q ss_pred             CCCCCCCC-CC-----C--CCCCCCCccccccccccccceeecCCceeEEeCCCCCCeeEEEEEecCCCCccEEEEEeee
Q 023674           69 MPSGHYPA-HP-----P--PPPPPPQYMEHQKAVTIRNDVNVKKETLRVEPDEENPGQFLVAFTFDAAAPGSITVAFFGK  140 (279)
Q Consensus        69 ~~p~~~~~-~~-----~--~~~~~~~~~~~q~t~~irn~VNi~K~Slrl~~~~~~~~~y~l~F~fDa~~~~~ItI~f~a~  140 (279)
                      .+..+.-- +.     .  ...++-+++ ||+++|||||||++|++++++.|..+++.|+|+|+|||+..|.|+|+||||
T Consensus        80 ~~~~~~~~l~~~r~~s~~~~~~~~~~~~-~~~av~i~~d~~l~k~~~~l~~d~~~P~~~~~sf~fda~~~g~itV~~fak  158 (349)
T KOG4265|consen   80 APIRPLIDLVNYRKPSLLLVCAPPDQYL-HQKAVTIRNDVNLDKETLRLDPDPLTPGLLLLSFTFDALAQGAITVLFFAK  158 (349)
T ss_pred             ccccchhhcccccccccceEecCCCccc-cccceeccchhhcccceEEeccCCCCcceeEEEEEeccccCccEEEEEecc
Confidence            11111110 00     0  123455688 999999999999999999999998899999999999999999999999999


Q ss_pred             ecCcceeeeccccccCCceeeeccccCceecCCCCCCCCCChhhhHh---------------------------------
Q 023674          141 EDVDCTLIATKEELLKPVTITFQQGLGQKFRQPCGTGIDLSMFDEIA---------------------------------  187 (279)
Q Consensus       141 E~~~~~l~~~~~~~~~~~~~~~~~gl~Q~F~~~sg~~id~~~~~~~e---------------------------------  187 (279)
                      |+..++++......+.++|++|.+|++|.|.+++ ++||++.|++++                                 
T Consensus       159 E~~~c~~~~~~~~~~~~~t~~f~~gl~Q~F~q~s-~~~D~~~~~~~~L~~~~~~~vyplsi~~~~~~~~~~~~~~~~~~~  237 (349)
T KOG4265|consen  159 EEVLCGLVLLVPDELPSITVHFEKGLGQLFLQPS-TGIDFSVMSIDDLSLSLDRRVYPLSISAEVQPSDVVESMGVFHVI  237 (349)
T ss_pred             ccccccccccccccCCCeeEEcccchhhhhcCCc-cccchhhcchhhhcccccCCeeeEEEEEEEeccccccccceeeEE
Confidence            9999999998888899999999999999999999 899999988776                                 


Q ss_pred             ----------------hhhhheeeccchhhhhhhhcCCCCCCCCCC----CCCccccccccCCCccEEecCCCcccCHHH
Q 023674          188 ----------------LTKQILWVNRVRYELQEIYGIGSTVAGDET----DSGKECVICLSEPRDTTVLPCRHMCMCSEC  247 (279)
Q Consensus       188 ----------------~lkq~i~~~~~~y~l~e~~~~~~s~~~~~~----~~~~~C~IC~~~~~~~~~lPCgH~~~C~~C  247 (279)
                                      ++||++|+++..|+++|+||++++..++.+    +++++|||||++.+|+++|||||+|+|.+|
T Consensus       238 tq~v~~~~~~G~~~~~~~kQ~~~v~g~~y~LqEiyGien~~v~~~~~~~~~~gkeCVIClse~rdt~vLPCRHLCLCs~C  317 (349)
T KOG4265|consen  238 TQAVYEKDEKGSIKIKVLKQILWVDGTRYLLQEIYGIENSTVEGTDADESESGKECVICLSESRDTVVLPCRHLCLCSGC  317 (349)
T ss_pred             EeeeeccCcCCceeeeeeeeEEEEeCceeeeehhhccccCCCCCCccccccCCCeeEEEecCCcceEEecchhhehhHhH
Confidence                            789999999999999999999976655433    678999999999999999999999999999


Q ss_pred             HHHHHhcCCCCccccccccceEEEecCCCCC
Q 023674          248 AKVLQFQTNRCPICRQPVERLLEIKVNNAAD  278 (279)
Q Consensus       248 ~~~l~~~~~~CPiCR~~i~~~~~i~~~~~~~  278 (279)
                      ++.|+.+.++|||||+.|..+++|++++++.
T Consensus       318 a~~Lr~q~n~CPICRqpi~~ll~i~~~~~~~  348 (349)
T KOG4265|consen  318 AKSLRYQTNNCPICRQPIEELLEIYVNKEDR  348 (349)
T ss_pred             HHHHHHhhcCCCccccchHhhheeccccccC
Confidence            9999999999999999999999999998764



>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
2ea5_A68 Solution Structure Of The Ring Domain Of The Human 2e-05
>pdb|2EA5|A Chain A, Solution Structure Of The Ring Domain Of The Human Cell Growth Regulator With Ring Finger Domain 1 Protein Length = 68 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Query: 209 GSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERL 268 GS+ ++ K+CV+C + + +LPCRH C+C C K Q +CP+CRQ V+ Sbjct: 4 GSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCRQFVQES 59 Query: 269 LEIK 272 + Sbjct: 60 FALS 63

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-22
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-21
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 4e-21
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 8e-18
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-17
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 2e-13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-08
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 4e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 6e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 9e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 4e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 6e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 7e-05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-04
4af8_A367 Metacaspase MCA2; hydrolase, cysteine peptidase, c 6e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 9e-04
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
 Score = 86.8 bits (215), Expect = 3e-22
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 209 GSTVAGDETDSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERL 268
           GS+      ++ K+CV+C +   +  +LPCRH C+C  C K  Q    +CP+CRQ V+  
Sbjct: 4   GSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCRQFVQES 59

Query: 269 LEIKV 273
             +  
Sbjct: 60  FALSG 64


>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>4af8_A Metacaspase MCA2; hydrolase, cysteine peptidase, caspase/hemoglobin fold; 1.40A {Trypanosoma brucei} PDB: 4afp_A 4afv_A 4afr_A Length = 367 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.56
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.54
2ea5_A68 Cell growth regulator with ring finger domain prot 99.5
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.4
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.32
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.3
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.27
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.26
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.23
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.22
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.22
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.22
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.2
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.2
2ect_A78 Ring finger protein 126; metal binding protein, st 99.16
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.16
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.15
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.15
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.13
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.12
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.11
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.11
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.1
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.02
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.0
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.99
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.96
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.96
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.95
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.94
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.93
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.93
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.92
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.89
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.89
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.88
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.87
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.87
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.86
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.86
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.83
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.81
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.79
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.78
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.76
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.75
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.75
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.72
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.67
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.67
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.59
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.56
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.53
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.36
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.32
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.14
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.11
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.0
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.98
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.97
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.9
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.66
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 96.66
3op0_A323 Signal transduction protein CBL-C; structural geno 96.65
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.66
3nw0_A238 Non-structural maintenance of chromosomes element 94.44
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.07
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.86
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 81.5
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
Probab=99.56  E-value=2e-15  Score=107.30  Aligned_cols=56  Identities=27%  Similarity=0.730  Sum_probs=51.6

Q ss_pred             CCCccccccccCCCccEEe--cCCCcccCHHHHHHHHhcCCCCccccccccceEEEec
Q 023674          218 DSGKECVICLSEPRDTTVL--PCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKV  273 (279)
Q Consensus       218 ~~~~~C~IC~~~~~~~~~l--PCgH~~~C~~C~~~l~~~~~~CPiCR~~i~~~~~i~~  273 (279)
                      +...+|.||+++.++++++  ||||+++|.+|+..|+.+..+||+||+.|..+++|++
T Consensus         5 ~~~~~C~IC~~~~~~~~~~~~pCgH~~~C~~C~~~~~~~~~~CPiCR~~i~~~i~i~~   62 (63)
T 2vje_B            5 NLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFI   62 (63)
T ss_dssp             GGGSBCTTTSSSBSCEEEEETTEEEEEECHHHHHHHHHTTCBCTTTCCBCCEEEEEEE
T ss_pred             CcCCCCcccCCcCCCeEEEecCCCCHhHHHHHHHHHHHhCCcCCCcCchhhceEEEec
Confidence            4567899999999999888  9999999999999998888899999999999999986



>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-13
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 7e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 8e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 3e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 6e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 8e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 8e-04
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 62.7 bits (152), Expect = 1e-13
 Identities = 14/58 (24%), Positives = 24/58 (41%)

Query: 218 DSGKECVICLSEPRDTTVLPCRHMCMCSECAKVLQFQTNRCPICRQPVERLLEIKVNN 275
            + + C IC    +D  + PC H+   S      + +   CP CR  ++    I V+ 
Sbjct: 21  STFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDP 78


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.26
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.16
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.08
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.02
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.02
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.97
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.93
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.88
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.88
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.84
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.73
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.73
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.7
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.63
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.59
d3buxb388 Cbl {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.65
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 90.57
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.96
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40  E-value=5.2e-14  Score=102.75  Aligned_cols=54  Identities=31%  Similarity=0.728  Sum_probs=47.1

Q ss_pred             CccccccccCCCccEEecCCCcccCHHHHHHHHh-cCCCCccccccccceEEEecC
Q 023674          220 GKECVICLSEPRDTTVLPCRHMCMCSECAKVLQF-QTNRCPICRQPVERLLEIKVN  274 (279)
Q Consensus       220 ~~~C~IC~~~~~~~~~lPCgH~~~C~~C~~~l~~-~~~~CPiCR~~i~~~~~i~~~  274 (279)
                      ...|.||++...+.++++|||. ||.+|+..|.. ++++||+||..|.....|.++
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~i~   77 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVD   77 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSSCC
T ss_pred             CCCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceeecC
Confidence            4579999999999999999999 99999999986 457899999999887666553



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure