Citrus Sinensis ID: 023677

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MDRAGGHTAGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVSSPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
ccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHcccccccccccccccHHHHHHHHHHHHHHHcHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHccc
ccccccccHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHcccccHHHccHHHcHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccHccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccHHHHccc
mdragghtaGELCAAVWRSALGFYcesfrfegggrqynrgrlfrrytnfrrsnsfNYMKYFVVGLnrtgkscrlrwvnylhpglkrgkmtpqEERLVLELHAKWGNRWSRIarklpgrtdneIKNYWRTHMRKKAQErkravsspsssssnysspsstvttvdsmpcpppqgkasfydtggnDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMkqdgngnvnfacpspmaapacwgysswdsiWKMDEADEESKMminlptddqFISSWAATLTG
mdragghtagELCAAVWRSALGFYCESFrfegggrqynrgrlfrrytnfrrsnsfnyMKYFVVGLNRTGKSCRLRWVNYlhpglkrgkmtpqEERLVLELhakwgnrwsriarklpgrtdneiknyWRTHMRKKAqerkravsspsssssnysspsSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMInlptddqfISSWAATLTG
MDRAGGHTAGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAvsspsssssnysspsstvttvdsmpCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
********AGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWR********************************************************TRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMD*****************FI*********
****************WRS***FYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHM*************************************************************************IWKDIELSEEK*M*********F******A*PACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
*********GELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHM**********************************PCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
*******TAGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERK****************************************************************DIWKDIELSEEKIMKQDGNGNVNFACPSP***********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRAGGHTAGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRAVSSPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMKQDGNGNVNFACPSPMAAPACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSWAATLTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q9LX82256 Transcription factor MYB4 no no 0.663 0.722 0.610 3e-50
Q4JL84235 Transcription factor MYB5 no no 0.612 0.727 0.590 1e-46
Q53NK6237 Myb-related protein MYBAS yes no 0.663 0.780 0.497 1e-40
Q4JL76242 Myb-related protein MYBAS no no 0.279 0.322 0.910 1e-37
P81391205 Myb-related protein 305 O N/A no 0.491 0.668 0.437 4e-30
Q9LK95226 Transcription factor MYB2 no no 0.523 0.646 0.401 3e-28
P81396198 Myb-related protein 340 O N/A no 0.512 0.722 0.431 6e-27
O22264 371 Transcription factor MYB1 no no 0.365 0.274 0.530 2e-25
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.261 0.248 0.657 1e-24
P81394268 Myb-related protein 315 O N/A no 0.268 0.279 0.64 2e-24
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function desciption
 Score =  198 bits (504), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 138/195 (70%), Gaps = 10/195 (5%)

Query: 62  VVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDN 121
           V GLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWS+IARKLPGRTDN
Sbjct: 38  VSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDN 97

Query: 122 EIKNYWRTHMRKKAQERKRAVS-SPSSSSSNYSSPSSTVTTVDSMPCPPPQ--GKASFYD 178
           EIKNYWRTHMRKKAQE+KR VS + S S+ + SS ++T T      C   +  G+ SFYD
Sbjct: 98  EIKNYWRTHMRKKAQEKKRPVSPTSSFSNCSSSSVTTTTTNTQDTSCHSRKSSGEVSFYD 157

Query: 179 TGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMK--QDGNGNVNFACPSPMAAP 236
           TGG+  TR    + +E E   YS+DDIW++I+ S   I+K  +D     +     P  A 
Sbjct: 158 TGGSRSTR---EMNQENE-DVYSLDDIWREIDHSAVNIIKPVKDIYSEQSHCLSYPNLAS 213

Query: 237 ACWGYSSWDSIWKMD 251
             W  SS DSIW MD
Sbjct: 214 PSWE-SSLDSIWNMD 227
Transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
225435070258 PREDICTED: transcription factor MYB59-li 0.752 0.813 0.618 4e-58
255580592244 r2r3-myb transcription factor, putative 0.727 0.831 0.617 3e-57
297746133235 unnamed protein product [Vitis vinifera] 0.684 0.812 0.597 1e-53
388522617217 unknown [Medicago truncatula] 0.709 0.912 0.558 5e-53
224054846241 predicted protein [Populus trichocarpa] 0.702 0.813 0.615 2e-52
334185755236 transcription factor MYB48 [Arabidopsis 0.724 0.855 0.546 4e-52
224104487228 predicted protein [Populus trichocarpa] 0.681 0.833 0.63 3e-51
449460969267 PREDICTED: transcription factor MYB48-li 0.709 0.741 0.576 1e-50
357454091243 Myb-like transcription factor [Medicago 0.695 0.798 0.549 4e-50
297815766258 hypothetical protein ARALYDRAFT_347705 [ 0.720 0.779 0.582 4e-50
>gi|225435070|ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 141/228 (61%), Positives = 160/228 (70%), Gaps = 18/228 (7%)

Query: 62  VVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDN 121
           V GLNRTGKSCRLRWVNYLHPGLKRGKMTP EERLVLELH++WGNRWSRIARKLPGRTDN
Sbjct: 39  VSGLNRTGKSCRLRWVNYLHPGLKRGKMTPHEERLVLELHSQWGNRWSRIARKLPGRTDN 98

Query: 122 EIKNYWRTHMRKKAQERKRAVSSPSSSSSNYSSPSSTVTTVDSMPCPPPQGKASFYDTGG 181
           EIKNYWRTHMRKKAQERKRA+S  S SS+  SS       VD +P    + + SF+DTGG
Sbjct: 99  EIKNYWRTHMRKKAQERKRAISPSSPSSNCSSSAPHN-PKVDLLPFSETEER-SFHDTGG 156

Query: 182 NDETRVAAALVEEYETS--CYSMDDIWKDIELSEEKIMKQDGNG----NVNFAC-PSPMA 234
                      EE + +   YSMDDIWKDI  SEE  +K   +G      +FAC P+PMA
Sbjct: 157 PKALAPTGKKTEEEKEADKGYSMDDIWKDIAFSEENTIKPVYDGYKEEGCDFACPPNPMA 216

Query: 235 APACWGYSSWDSIWKMDEADEESKMMINLPTDDQFISSW---AATLTG 279
           +P  W Y   DS+W+MDE  EESKM   LP  DQFISS+    A+LTG
Sbjct: 217 SPV-WDYCP-DSLWRMDE--EESKMF--LPMSDQFISSYEHGMASLTG 258

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255580592|ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223529316|gb|EEF31285.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297746133|emb|CBI16189.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388522617|gb|AFK49370.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224054846|ref|XP_002298375.1| predicted protein [Populus trichocarpa] gi|222845633|gb|EEE83180.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334185755|ref|NP_001190018.1| transcription factor MYB48 [Arabidopsis thaliana] gi|332644599|gb|AEE78120.1| transcription factor MYB48 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224104487|ref|XP_002313452.1| predicted protein [Populus trichocarpa] gi|222849860|gb|EEE87407.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460969|ref|XP_004148216.1| PREDICTED: transcription factor MYB48-like [Cucumis sativus] gi|449519206|ref|XP_004166626.1| PREDICTED: transcription factor MYB48-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357454091|ref|XP_003597326.1| Myb-like transcription factor [Medicago truncatula] gi|355486374|gb|AES67577.1| Myb-like transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|297815766|ref|XP_002875766.1| hypothetical protein ARALYDRAFT_347705 [Arabidopsis lyrata subsp. lyrata] gi|297321604|gb|EFH52025.1| hypothetical protein ARALYDRAFT_347705 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2075236256 MYB48 "myb domain protein 48" 0.716 0.781 0.553 1.5e-51
TAIR|locus:2174324235 MYB59 "myb domain protein 59" 0.283 0.336 0.962 7.7e-50
TAIR|locus:2140847261 MYB79 "myb domain protein 79" 0.340 0.363 0.645 1.9e-33
TAIR|locus:2089812276 MYB121 "myb domain protein 121 0.275 0.278 0.727 4.9e-33
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.340 0.353 0.635 1e-32
TAIR|locus:2084269323 MYB108 "myb domain protein 108 0.272 0.235 0.671 1.6e-30
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.265 0.261 0.689 3.3e-30
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.250 0.309 0.7 1.4e-29
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.250 0.327 0.7 2.3e-29
TAIR|locus:2102013238 MYB27 "myb domain protein 27" 0.268 0.315 0.72 9.1e-29
TAIR|locus:2075236 MYB48 "myb domain protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 535 (193.4 bits), Expect = 1.5e-51, P = 1.5e-51
 Identities = 118/213 (55%), Positives = 135/213 (63%)

Query:    62 VVGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDN 121
             V GLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWS+IARKLPGRTDN
Sbjct:    38 VSGLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDN 97

Query:   122 EIKNYWRTHMRKKAQERKRAXXXXXXXXX-XXXXXXXXXXXXXXXXCPPPQ--GKASFYD 178
             EIKNYWRTHMRKKAQE+KR                           C   +  G+ SFYD
Sbjct:    98 EIKNYWRTHMRKKAQEKKRPVSPTSSFSNCSSSSVTTTTTNTQDTSCHSRKSSGEVSFYD 157

Query:   179 TGGNDETRVAAALVEEYETSCYSMDDIWKDIELSEEKIMK--QDGNGNVNFACPSPMAAP 236
             TGG+  TR    + +E E   YS+DDIW++I+ S   I+K  +D     +     P  A 
Sbjct:   158 TGGSRSTR---EMNQENE-DVYSLDDIWREIDHSAVNIIKPVKDIYSEQSHCLSYPNLAS 213

Query:   237 ACWGYSSWDSIWKMDEADEESKMMINLPTDDQF 269
               W  SS DSIW MD AD+ SK+      +DQF
Sbjct:   214 PSWE-SSLDSIWNMD-ADK-SKISSYF-ANDQF 242
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS;TAS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
TAIR|locus:2174324 MYB59 "myb domain protein 59" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140847 MYB79 "myb domain protein 79" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089812 MYB121 "myb domain protein 121" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102013 MYB27 "myb domain protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
MYB206
hypothetical protein (241 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-30
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 4e-28
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-15
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-11
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-05
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  117 bits (295), Expect = 2e-30
 Identities = 49/75 (65%), Positives = 60/75 (80%)

Query: 64  GLNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEI 123
           GL R GKSCRLRW+NYL P LKRG  + QEE L++ELHA  GNRWS+IA +LPGRTDNEI
Sbjct: 45  GLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEI 104

Query: 124 KNYWRTHMRKKAQER 138
           KN W + ++KK ++R
Sbjct: 105 KNLWNSCLKKKLRQR 119

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
PLN03212249 Transcription repressor MYB5; Provisional 99.97
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
PLN03091 459 hypothetical protein; Provisional 99.96
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.76
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.46
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.45
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.43
PLN03212249 Transcription repressor MYB5; Provisional 99.3
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.27
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.26
PLN03091 459 hypothetical protein; Provisional 99.21
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.14
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.08
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.01
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.8
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.3
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.24
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.2
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.09
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.49
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.46
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.39
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.22
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.16
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.79
KOG1279506 consensus Chromatin remodeling factor subunit and 96.62
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.59
PRK13923170 putative spore coat protein regulator protein YlbO 96.39
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.07
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 94.79
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.79
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.87
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 92.9
KOG4282345 consensus Transcription factor GT-2 and related pr 92.79
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.57
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 91.81
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 91.3
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 91.22
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 90.66
PLN031421033 Probable chromatin-remodeling complex ATPase chain 89.48
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.07
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 88.54
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 88.22
KOG1194 534 consensus Predicted DNA-binding protein, contains 86.52
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 85.65
KOG1279506 consensus Chromatin remodeling factor subunit and 84.89
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=99.97  E-value=4.4e-31  Score=238.45  Aligned_cols=115  Identities=42%  Similarity=0.683  Sum_probs=101.8

Q ss_pred             cccccccccccccCcccchHHHHHHHHHhhhhcCCcCHHHHHHHc-CCCCHHHHHHHHHHhcCCCCCCCCCCHHHHHHHH
Q 023677           20 ALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVG-LNRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVL   98 (279)
Q Consensus        20 ~l~~~l~k~~wt~~ed~~~~~~llr~l~~~~~~g~~~W~~IA~~~-~~Rt~~QCr~RW~n~L~P~l~kg~WT~eED~~Ll   98 (279)
                      ...+.+++++|+.+||+.     |+.+++.+  |..+|.+||..+ ++|+++|||+||.|||+|+|++++||.|||++|+
T Consensus        18 c~K~glKRg~WT~EEDe~-----L~~lV~ky--G~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLl   90 (249)
T PLN03212         18 CTKMGMKRGPWTVEEDEI-----LVSFIKKE--GEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLIL   90 (249)
T ss_pred             cccCCCcCCCCCHHHHHH-----HHHHHHHh--CcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHH
Confidence            367889999999988774     55555543  456999999987 6999999999999999999999999999999999


Q ss_pred             HHHHHhcCchhHHhhhCCCCCHHHHHHHHHHHhhHHHHhhhhc
Q 023677           99 ELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA  141 (279)
Q Consensus        99 ~lv~~~G~~W~~Ia~~lpgRT~~q~knRw~~llr~~~~~~~~~  141 (279)
                      ++|.+||++|+.||++|||||+++|||||+.+++++.......
T Consensus        91 el~~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~  133 (249)
T PLN03212         91 RLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGID  133 (249)
T ss_pred             HHHHhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCC
Confidence            9999999999999999999999999999999999987665443

>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-15
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-15
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-15
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 2e-15
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 5e-15
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-12
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 1e-09
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 4e-09
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 50/69 (72%)
Query: 67  RTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNY 126
           R GK CR RW N+L+P +K+   T +E+R++ + H + GNRW+ IA+ LPGRTDN IKN+
Sbjct: 91  RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNH 150
Query: 127 WRTHMRKKA 135
           W + MR+K 
Sbjct: 151 WNSTMRRKV 159
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-42
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-40
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-40
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-40
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-39
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-36
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-17
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-08
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-05
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-07
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-06
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-06
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-04
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 7e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 9e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-05
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-05
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-05
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 8e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 6e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 6e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 8e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  140 bits (356), Expect = 2e-42
 Identities = 31/92 (33%), Positives = 47/92 (51%)

Query: 66  NRTGKSCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKN 125
           NR+ K CR RW N+L P + +   TP+E+  +   + K G++WS IA+ +PGRTDN IKN
Sbjct: 34  NRSPKQCRERWFNHLDPAVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKN 93

Query: 126 YWRTHMRKKAQERKRAVSSPSSSSSNYSSPSS 157
            W + + K+               S     + 
Sbjct: 94  RWNSSISKRISTNSNHKEILLPDRSKKRKAAD 125
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.93
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.87
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.8
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.75
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.74
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.72
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.68
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.67
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.65
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.62
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.62
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.36
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.57
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.56
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.51
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.48
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.48
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.46
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.43
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.41
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.39
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.39
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.39
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.38
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.37
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.37
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.36
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.36
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.35
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.34
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.34
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.31
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.31
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.26
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.25
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.23
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.23
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.17
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.16
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.15
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.14
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.01
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.93
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.92
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.84
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.75
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.69
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.67
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.57
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.46
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.43
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.33
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.6
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.15
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.1
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.93
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 97.68
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.57
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.53
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.52
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.46
2crg_A70 Metastasis associated protein MTA3; transcription 97.45
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.44
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.22
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.08
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.07
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.42
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 95.84
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 94.58
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 93.99
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 93.73
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 93.09
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.86
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 91.91
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.84
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 91.46
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 90.88
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 89.75
2crg_A70 Metastasis associated protein MTA3; transcription 86.05
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 84.7
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 82.67
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 81.13
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=100.00  E-value=7.2e-36  Score=245.47  Aligned_cols=124  Identities=31%  Similarity=0.517  Sum_probs=96.6

Q ss_pred             CCCccccccccccccccccccccccccccCcccchHHHHHHHHHhhhhcCCcCHHHHHHHcCCCCHHHHHHHHHHhcCCC
Q 023677            4 AGGHTAGELCAAVWRSALGFYCESFRFEGGGRQYNRGRLFRRYTNFRRSNSFNYMKYFVVGLNRTGKSCRLRWVNYLHPG   83 (279)
Q Consensus         4 ~gg~~~g~~C~~rW~~~l~~~l~k~~wt~~ed~~~~~~llr~l~~~~~~g~~~W~~IA~~~~~Rt~~QCr~RW~n~L~P~   83 (279)
                      +...+++.||+.||.+.|+|.+++++||.+||..     |..++..  +|..+|.+||..+++||++||++||.++|+|.
T Consensus         4 ~~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~-----L~~~v~~--~g~~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~   76 (128)
T 1h8a_C            4 VIKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQR-----VIEHVQK--YGPKRWSDIAKHLKGRIGKQCRERWHNHLNPE   76 (128)
T ss_dssp             ------------------CTTCCCSCCCHHHHHH-----HHHHHHH--TCSCCHHHHHHHSSSCCHHHHHHHHHHTTCSS
T ss_pred             ccCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHH-----HHHHHHH--HCCCCHHHHHHHhcCCcHHHHHHHHHHhcccc
Confidence            3456899999999999999999999999888874     3334433  45568999999999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHhcCchhHHhhhCCCCCHHHHHHHHHHHhhHH
Q 023677           84 LKRGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKK  134 (279)
Q Consensus        84 l~kg~WT~eED~~Ll~lv~~~G~~W~~Ia~~lpgRT~~q~knRw~~llr~~  134 (279)
                      +++++||+|||.+|+++|.+||++|+.||++|||||+++|+|||+.+++++
T Consensus        77 ~~~~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~~~~  127 (128)
T 1h8a_C           77 VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRK  127 (128)
T ss_dssp             SCCSCCCHHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTTTC-
T ss_pred             cccccCCHHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999999999875
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-13
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 7e-12
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-11
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-05
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-05
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 7e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-04
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 62.5 bits (152), Expect = 6e-14
 Identities = 23/47 (48%), Positives = 34/47 (72%)

Query: 86  RGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMR 132
           +   T +E+R++ + H + GNRW+ IA+ LPGRTDN IKN+W + MR
Sbjct: 1   KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR 47
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.74
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.68
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.62
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.6
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.53
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.5
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.49
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.48
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.47
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.43
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.41
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.37
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.35
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.29
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.2
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.17
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.07
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.98
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.94
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.86
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.85
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.81
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.79
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.14
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.12
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.04
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.03
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.94
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.51
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 96.63
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.31
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.48
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 93.29
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 92.82
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.92
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 88.61
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 87.64
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.74  E-value=1.1e-18  Score=118.77  Aligned_cols=47  Identities=49%  Similarity=0.954  Sum_probs=45.4

Q ss_pred             CCCCCHHHHHHHHHHHHHhcCchhHHhhhCCCCCHHHHHHHHHHHhh
Q 023677           86 RGKMTPQEERLVLELHAKWGNRWSRIARKLPGRTDNEIKNYWRTHMR  132 (279)
Q Consensus        86 kg~WT~eED~~Ll~lv~~~G~~W~~Ia~~lpgRT~~q~knRw~~llr  132 (279)
                      |++||+|||++|+++|++||++|+.||.+|||||+++|||||+.++|
T Consensus         1 K~~WT~eED~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~knr~~~~lr   47 (47)
T d1gv2a2           1 KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR   47 (47)
T ss_dssp             CCCCCHHHHHHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC
T ss_pred             CCCCCHHHHHHHHHHHHHHhhHHHHHHhHcCCCCHHHHHHHHHHHcC
Confidence            57999999999999999999999999999999999999999999886
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure