Citrus Sinensis ID: 023678

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWVSFKMNFFVSPCSCN

ccccccccccccccccccccccccccccEEEEccccccccEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccEEEEccEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccEEcccccHHHHcccccccccccEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEEc

****************************************SVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWVSFKMNFFVSPCSCN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aspartate-semialdehyde dehydrogenase	Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.	probable	O67716

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YV3, chain A
Confidence level:very confident
Coverage over the Query: 53-274
View the alignment between query and template
View the model in PyMOL

Template: 3GGO, chain A
Confidence level:probable
Coverage over the Query: 34-134
View the alignment between query and template
View the model in PyMOL