Citrus Sinensis ID: 023680


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI
cccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccccccEEEcccccc
************LNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein SKP2A Component of SCF(SKP2A) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (including cell cycle repressors). Acts as an auxin receptor. Regulates the stability of the transcription factors E2FC and DPB, repressors of cell proliferation. Confers increase tolerance to osmotic stress by promoting cell division, especially in meristems. Promotes the formation of lateral root primordia.probableQ9LPL4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 43-248
View the alignment between query and template
View the model in PyMOL
Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 97-279
View the alignment between query and template
View the model in PyMOL
Template: 2AST, chain B
Confidence level:very confident
Coverage over the Query: 5-277
View the alignment between query and template
View the model in PyMOL