Citrus Sinensis ID: 023680

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

ccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccccccEEEcccccc

ccccccccccccHHHHHHHHHHccccHcccccccccccccccHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccHHHccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHcccccEEEcccccc

mvgeatnlssedLNLCFEKMMMAgagadraggvkmdgvvitewkDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTlvlrqdkpqledNAVEAIANschdlqdldlsksfklsdrSLYALAhgcpnltrlnisgctsfsDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNqlqslnlgwcedvgdvgvmnlaygcpdlrsldlcgcvcitgissadviirpsrnccvvkrecsigcfi

mvgeatnlsseDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGissadviirpsrnccvvkrecsigcfi

MVGEATNLSSEDLNLCFEKmmmagagadraggVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

************LNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCF*

*****************************************EWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

********SSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

*********SEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGCFI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		279	2.2.26 [Sep-21-2011]
Q9LPL4		360	F-box protein SKP2A OS=Ar	yes	no	0.838	0.65	0.725	1e-100
O49286		360	F-box protein SKP2B OS=Ar	no	no	0.856	0.663	0.712	4e-99
A6H779		423	F-box/LRR-repeat protein	yes	no	0.616	0.406	0.356	6e-19
Q5R3Z8		423	F-box/LRR-repeat protein	yes	no	0.673	0.444	0.324	4e-18
Q9UKC9		423	F-box/LRR-repeat protein	yes	no	0.673	0.444	0.324	4e-18
Q8BH16		423	F-box/LRR-repeat protein	yes	no	0.616	0.406	0.327	9e-18
Q96IG2		436	F-box/LRR-repeat protein	no	no	0.645	0.412	0.305	2e-16
Q58DG6		436	F-box/LRR-repeat protein	no	no	0.645	0.412	0.305	2e-16
Q9QZH7		276	F-box/LRR-repeat protein	no	no	0.645	0.652	0.300	4e-16
Q9CZV8		436	F-box/LRR-repeat protein	no	no	0.616	0.394	0.316	5e-16

>sp\|Q9LPL4\|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1	Back alignment and function desciption

 Score =  365 bits (937), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/251 (72%), Positives = 207/251 (82%), Gaps = 17/251 (6%)

Query: 1   MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDE 60
           M GEA    S +L+ CF+KM             KM+G+ I EWKDIP+ELL+RILSLVD+
Sbjct: 3   MGGEA----SMELDQCFQKM-------------KMEGISIKEWKDIPVELLMRILSLVDD 45

Query: 61  PTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120
             VIVASGVC+GWRDAI  GLT L LSWC NNMN+LVLSL PK  KLQTL LRQDKPQLE
Sbjct: 46  RNVIVASGVCTGWRDAISFGLTRLRLSWCNNNMNSLVLSLVPKFVKLQTLNLRQDKPQLE 105

Query: 121 DNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLC 180
           DNAVEAIAN CH+LQ+LDLSKS K++DRSLYALAHGCP+LT+LN+SGCTSFSD A+AYL 
Sbjct: 106 DNAVEAIANHCHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLT 165

Query: 181 GFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLR 240
            FCRKLK+LNLCGCVKA TD AL+AIG NCNQ+QSLNLGWCE++ D GVM+LAYGCPDLR
Sbjct: 166 RFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLR 225

Query: 241 SLDLCGCVCIT 251
           +LDLCGCV IT
Sbjct: 226 TLDLCGCVLIT 236

Component of SCF(SKP2A) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (including cell cycle repressors). Acts as an auxin receptor. Regulates the stability of the transcription factors E2FC and DPB, repressors of cell proliferation. Confers increase tolerance to osmotic stress by promoting cell division, especially in meristems. Promotes the formation of lateral root primordia.
Arabidopsis thaliana (taxid: 3702)

>sp\|O49286\|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1	Back alignment and function description

>sp\|A6H779\|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q5R3Z8\|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UKC9\|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3	Back alignment and function description

>sp\|Q8BH16\|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1	Back alignment and function description

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9QZH7\|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		279
255558466		373	F-box/LRR-repeat protein, putative [Rici	0.896	0.670	0.840	1e-115
224082382		363	predicted protein [Populus trichocarpa]	0.860	0.661	0.796	1e-109
449453019		376	PREDICTED: F-box protein SKP2A-like [Cuc	0.896	0.664	0.771	1e-103
359492292		370	PREDICTED: F-box protein SKP2B-like [Vit	0.878	0.662	0.776	1e-103
302142727		428	unnamed protein product [Vitis vinifera]	0.878	0.572	0.772	1e-103
224066761		358	predicted protein [Populus trichocarpa]	0.863	0.673	0.775	1e-103
363807426		371	uncharacterized protein LOC100793275 [Gl	0.931	0.700	0.723	1e-102
356546950		375	PREDICTED: F-box protein SKP2B-like isof	0.774	0.576	0.729	1e-101
356515961		372	PREDICTED: F-box protein SKP2A-like [Gly	0.896	0.672	0.733	1e-100
217073061		368	unknown [Medicago truncatula]	0.885	0.671	0.737	1e-100

>gi\|255558466\|ref\|XP_002520258.1\| F-box/LRR-repeat protein, putative [Ricinus communis] gi\|223540477\|gb\|EEF42044.1\| F-box/LRR-repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/251 (84%), Positives = 227/251 (90%), Gaps = 1/251 (0%)

Query: 1   MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDE 60
           MVG    L SEDLN CFEK+MMAGA  +  G VKM+GVVITEWKDIPMELLLRI+SLVD+
Sbjct: 1   MVG-GGKLRSEDLNRCFEKLMMAGAAGNTEGRVKMEGVVITEWKDIPMELLLRIVSLVDD 59

Query: 61  PTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120
            T+I+ASGVCSGWRDAICLGLTHL LSWCKN+MNNLVL LAPK TKL+TLVLRQDKPQLE
Sbjct: 60  RTIIMASGVCSGWRDAICLGLTHLCLSWCKNHMNNLVLWLAPKFTKLETLVLRQDKPQLE 119

Query: 121 DNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLC 180
           DNAVEAIA  CHDL+DLDLSKSFKL+D SLYALAHGCPNLT+LNISGCTSFSD  L YL 
Sbjct: 120 DNAVEAIARYCHDLEDLDLSKSFKLTDCSLYALAHGCPNLTKLNISGCTSFSDGGLEYLT 179

Query: 181 GFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLR 240
           GFCRKLKILNLCGCVKAATD ALQAIGRNC+QLQSLNLGWCE+VGDVGVM+LAYGCPDLR
Sbjct: 180 GFCRKLKILNLCGCVKAATDRALQAIGRNCSQLQSLNLGWCENVGDVGVMSLAYGCPDLR 239

Query: 241 SLDLCGCVCIT 251
           +LDLCGCV IT
Sbjct: 240 TLDLCGCVNIT 250

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224082382\|ref\|XP_002306672.1\| predicted protein [Populus trichocarpa] gi\|222856121\|gb\|EEE93668.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449453019\|ref\|XP_004144256.1\| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] gi\|449517068\|ref\|XP_004165568.1\| PREDICTED: F-box protein SKP2A-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359492292\|ref\|XP_002268441.2\| PREDICTED: F-box protein SKP2B-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|302142727\|emb\|CBI19930.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224066761\|ref\|XP_002302202.1\| predicted protein [Populus trichocarpa] gi\|222843928\|gb\|EEE81475.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|363807426\|ref\|NP_001242641.1\| uncharacterized protein LOC100793275 [Glycine max] gi\|255644880\|gb\|ACU22940.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|356546950\|ref\|XP_003541882.1\| PREDICTED: F-box protein SKP2B-like isoform 1 [Glycine max] gi\|356546952\|ref\|XP_003541883.1\| PREDICTED: F-box protein SKP2B-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|356515961\|ref\|XP_003526665.1\| PREDICTED: F-box protein SKP2A-like [Glycine max]	Back alignment and taxonomy information

>gi\|217073061\|gb\|ACJ84890.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		279
TAIR\|locus:2027082		360	SKP2A [Arabidopsis thaliana (t	0.784	0.608	0.785	2.3e-94
TAIR\|locus:2025222		360	SKP2B "AT1G77000" [Arabidopsis	0.845	0.655	0.713	2.7e-93
UNIPROTKB\|F1NHD2		423	FBXL2 "Uncharacterized protein	0.659	0.434	0.342	1.4e-23
UNIPROTKB\|A6H779		423	FBXL2 "F-box/LRR-repeat protei	0.659	0.434	0.347	2.6e-22
UNIPROTKB\|F1PWK1		422	FBXL2 "Uncharacterized protein	0.659	0.436	0.326	4.3e-22
UNIPROTKB\|Q9UKC9		423	FBXL2 "F-box/LRR-repeat protei	0.659	0.434	0.326	5.6e-22
UNIPROTKB\|Q5R3Z8		423	FBXL2 "F-box/LRR-repeat protei	0.659	0.434	0.326	5.6e-22
MGI\|MGI:1919429		423	Fbxl2 "F-box and leucine-rich	0.616	0.406	0.327	2.1e-21
RGD\|1562243		422	Fbxl2 "F-box and leucine-rich	0.616	0.407	0.327	3.5e-21
MGI\|MGI:1919444		436	Fbxl20 "F-box and leucine-rich	0.616	0.394	0.316	9e-19

TAIR\|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 939 (335.6 bits), Expect = 2.3e-94, P = 2.3e-94
 Identities = 172/219 (78%), Positives = 195/219 (89%)

Query:    33 VKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNN 92
             +KM+G+ I EWKDIP+ELL+RILSLVD+  VIVASGVC+GWRDAI  GLT L LSWC NN
Sbjct:    18 MKMEGISIKEWKDIPVELLMRILSLVDDRNVIVASGVCTGWRDAISFGLTRLRLSWCNNN 77

Query:    93 MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 152
             MN+LVLSL PK  KLQTL LRQDKPQLEDNAVEAIAN CH+LQ+LDLSKS K++DRSLYA
Sbjct:    78 MNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYA 137

Query:   153 LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQ 212
             LAHGCP+LT+LN+SGCTSFSD A+AYL  FCRKLK+LNLCGCVKA TD AL+AIG NCNQ
Sbjct:   138 LAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQ 197

Query:   213 LQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCIT 251
             +QSLNLGWCE++ D GVM+LAYGCPDLR+LDLCGCV IT
Sbjct:   198 MQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLIT 236

GO:0005737 "cytoplasm" evidence=ISM

GO:0005515 "protein binding" evidence=IPI

GO:0019005 "SCF ubiquitin ligase complex" evidence=IDA;IPI

GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IDA;IPI

GO:0005634 "nucleus" evidence=IDA

GO:0010311 "lateral root formation" evidence=IMP

GO:0051781 "positive regulation of cell division" evidence=IMP

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0016567 "protein ubiquitination" evidence=IDA

GO:0071365 "cellular response to auxin stimulus" evidence=IDA

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA

TAIR\|locus:2025222 SKP2B "AT1G77000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

MGI\|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LPL4	SKP2A_ARATH	No assigned EC number	0.7250	0.8387	0.65	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_V1038	hypothetical protein (364 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		279
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-17
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	4e-09
pfam12937		47	pfam12937, F-box-like, F-box-like	0.001
smart00367		26	smart00367, LRR_CC, Leucine-rich repeat - CC (cyst	0.002

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 78.1 bits (193), Expect = 3e-17
 Identities = 48/137 (35%), Positives = 67/137 (48%), Gaps = 4/137 (2%)

Query: 130 SCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKIL 189
           +C+ L+ L L  S  + D  L ALA  CPNL  L++  C + +D  +  L   C KL+ +
Sbjct: 50  NCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTI 109

Query: 190 NLCGCVK--AATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGC-PDLRSLDLCG 246
           NL         TD +L A+G+NC  LQ++    C DV D GV  LA GC   L  L L  
Sbjct: 110 NLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNN 168

Query: 247 CVCITGISSADVIIRPS 263
           C  +T  S   ++    
Sbjct: 169 CRNLTDQSIPAILASNY 185

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|221867 pfam12937, F-box-like, F-box-like	Back alignment and domain information

>gnl\|CDD\|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		279
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.95
KOG4341		483	consensus F-box protein containing LRR [General fu	99.95
KOG4341		483	consensus F-box protein containing LRR [General fu	99.92
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.8
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.56
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.51
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.51
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.48
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.01
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.94
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.92
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.92
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.87
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.85
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.84
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.68
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.62
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.43
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.36
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	98.28
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.2
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.09
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	98.08
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.07
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.04
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.89
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.87
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	97.86
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.81
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.77
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	97.59
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.46
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.44
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.3
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.11
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.05
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.03
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	96.81
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.7
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	96.58
KOG4308		478	consensus LRR-containing protein [Function unknown	96.56
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.53
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	96.48
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.45
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	96.38
PLN03150		623	hypothetical protein; Provisional	96.32
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.2
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.13
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.01
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	96.0
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	95.95
KOG4308		478	consensus LRR-containing protein [Function unknown	95.85
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.61
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	95.59
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	95.55
PLN03150		623	hypothetical protein; Provisional	95.54
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	95.24
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	95.11
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	94.61
KOG2997		366	consensus F-box protein FBX9 [General function pre	94.36
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	94.21
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	94.08
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	93.94
PRK15386		426	type III secretion protein GogB; Provisional	93.61
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	93.3
KOG0472		565	consensus Leucine-rich repeat protein [Function un	93.0
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	92.93
KOG0617		264	consensus Ras suppressor protein (contains leucine	92.76
PRK15386		426	type III secretion protein GogB; Provisional	92.64
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	91.8
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	90.98
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	90.51
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	90.26
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	89.63
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	89.57
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	89.21
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	88.24
KOG4237		498	consensus Extracellular matrix protein slit, conta	87.98
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	87.01
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	86.67
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	84.94
KOG0472		565	consensus Leucine-rich repeat protein [Function un	83.29
PF13013		109	F-box-like_2: F-box-like domain	82.84
KOG4237		498	consensus Extracellular matrix protein slit, conta	80.55

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.95  E-value=3.4e-28  Score=191.12  Aligned_cols=226  Identities=25%  Similarity=0.358  Sum_probs=178.5

Q ss_pred             CCCCCCCHHHHHHHcccCChhHHHHHHhcChhHHHhhcC--C--------------------------------------
Q 023680           41 TEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICL--G--------------------------------------   80 (279)
Q Consensus        41 ~~~~~Lp~~il~~I~~~L~~~~l~~~~~vc~~w~~~~~~--~--------------------------------------   80 (279)
                      -.|..+|||++..||+.|..+++..++.|||+|+++...  .                                      
T Consensus        96 v~~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p~~l~~l~~rgV~v~Rlar~~~~~pr  175 (419)
T KOG2120|consen   96 VSWDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHPDVLGRLLSRGVIVFRLARSFMDQPR  175 (419)
T ss_pred             CCcccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccChhHHHHHHhCCeEEEEcchhhhcCch
Confidence            359999999999999999999999999999999987522  1                                      


Q ss_pred             -----------CcEEEccCCCCcchHHHHHHcccCCCceEEEeeCCCCCCCHHHHHHHHhhCCCCCeEecCCCCCCCHHH
Q 023680           81 -----------LTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRS  149 (279)
Q Consensus        81 -----------l~~l~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~  149 (279)
                                 +++++++.. ..+...+..+...|.+|+.|.+.  ...+.|.....+++ ..+|+.|+|+.|.+++..+
T Consensus       176 lae~~~~frsRlq~lDLS~s-~it~stl~~iLs~C~kLk~lSlE--g~~LdD~I~~~iAk-N~~L~~lnlsm~sG~t~n~  251 (419)
T KOG2120|consen  176 LAEHFSPFRSRLQHLDLSNS-VITVSTLHGILSQCSKLKNLSLE--GLRLDDPIVNTIAK-NSNLVRLNLSMCSGFTENA  251 (419)
T ss_pred             hhhhhhhhhhhhHHhhcchh-heeHHHHHHHHHHHHhhhhcccc--ccccCcHHHHHHhc-cccceeeccccccccchhH
Confidence                       333333331 22334555666778888888888  66778877777777 7889999999999999999


Q ss_pred             HHHHHhcCCCCCEEEecCCCCCCHHHHHHHHHc-CCCCcEEEcCCCCCCCCHHHHHHHHhcCCCCCeEeccCCCCCCHHH
Q 023680          150 LYALAHGCPNLTRLNISGCTSFSDHALAYLCGF-CRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVG  228 (279)
Q Consensus       150 l~~l~~~~~~L~~L~L~~~~~~~~~~~~~l~~~-~~~L~~L~L~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~  228 (279)
                      +..++++|+.|..|++++|.-.++. +..+..+ .++|..|+|+|+...+.+..+..+...||+|.+||++.|..+++.-
T Consensus       252 ~~ll~~scs~L~~LNlsWc~l~~~~-Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~~~~  330 (419)
T KOG2120|consen  252 LQLLLSSCSRLDELNLSWCFLFTEK-VTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLKNDC  330 (419)
T ss_pred             HHHHHHhhhhHhhcCchHhhccchh-hhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccCchH
Confidence            9999999999999999998544444 5555444 4889999999987667777888888889999999999988888855


Q ss_pred             HHHHHhcCCCCCEEeccCCCCCChHHHHHHhhccccCcccccccccccc
Q 023680          229 VMNLAYGCPDLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGC  277 (279)
Q Consensus       229 l~~l~~~~~~L~~L~l~~c~~i~~~~~~~l~~~~~~~c~~~~~~~~~~~  277 (279)
                      +..+ ...+.|++|.++.|-.|.++.+..+     ..=|.+..++++||
T Consensus       331 ~~~~-~kf~~L~~lSlsRCY~i~p~~~~~l-----~s~psl~yLdv~g~  373 (419)
T KOG2120|consen  331 FQEF-FKFNYLQHLSLSRCYDIIPETLLEL-----NSKPSLVYLDVFGC  373 (419)
T ss_pred             HHHH-HhcchheeeehhhhcCCChHHeeee-----ccCcceEEEEeccc
Confidence            5555 4568999999999999988888777     44567777777777

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13013 F-box-like_2: F-box-like domain	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		279
1fs2_A		272	Insights Into Scf Ubiquitin Ligases From The Struct		7e-13
1fqv_A		336	Insights Into Scf Ubiquitin Ligases From The Struct		3e-12
3ogk_B		592	Structure Of Coi1-Ask1 In Complex With Coronatine A		3e-05
2p1m_B		594	Tir1-ask1 Complex Structure Length = 594		3e-05

>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272

Back alignment and structure

Iteration: 1

Score = 70.9 bits (172), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 61/209 (29%), Positives = 90/209 (43%), Gaps = 21/209 (10%) Query: 43 WKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAP 102 W +P ELLL I S + P ++ SGVC W SL Sbjct: 9 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDE------------------SLWQ 50 Query: 103 KLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTR 162 L + + + +E + + I + C LQ+L L + +LSD + LA NL R Sbjct: 51 TLDEFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL-EGLRLSDPIVNTLAKNS-NLVR 108 Query: 163 LNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNL-GWC 221 LN+SGC+ FS+ AL L C +L LNL C + A+ + LNL G+ Sbjct: 109 LNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR 168 Query: 222 EDVGDVGVMNLAYGCPDLRSLDLCGCVCI 250 +++ + L CP+L LDL V + Sbjct: 169 KNLQKSDLSTLVRRCPNLVHLDLSDSVML 197

PyMOL of 1fs2

>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336

Back alignment and structure

>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592

Back alignment and structure

>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		279
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-42
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-32
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-23
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-38
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-29
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	9e-29
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-26
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-26
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-16
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-28
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-27
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-24
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-23
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-22
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-22
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-22
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-22
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-14
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	2e-14
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-08
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	9e-11
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	5e-10
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	6e-09
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	9e-10
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-07
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-08
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	3e-08
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	3e-07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-05
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	4e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	7e-05
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	9e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	8e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-04

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

 Score =  146 bits (371), Expect = 3e-42
 Identities = 62/232 (26%), Positives = 94/232 (40%), Gaps = 23/232 (9%)

Query: 41  TEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMN------ 94
             W  +P ELLL I S +  P ++  SGVC  W           +L     N++      
Sbjct: 7   VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGR 66

Query: 95  --------------NLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLS 140
                          +   LA   +  +   +      +E + +  I + C  LQ+L L 
Sbjct: 67  LLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLE 126

Query: 141 KSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATD 200
              +LSD  +  LA    NL RLN+SGC+ FS+ AL  L   C +L  LNL  C      
Sbjct: 127 -GLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEK 184

Query: 201 YALQAIGRNCNQLQSLNL-GWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCIT 251
           +   A+      +  LNL G+ +++    +  L   CP+L  LDL   V + 
Sbjct: 185 HVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLK 236

PyMOL of 2ast

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		279
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.96
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.92
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.9
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.88
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.8
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.79
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.68
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.62
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.6
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.58
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.58
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.57
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.56
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.54
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.45
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.33
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.29
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.23
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.22
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.16
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.01
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.98
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.97
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.94
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.92
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.92
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.88
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.88
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.87
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.86
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.85
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.85
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.84
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.84
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.83
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.82
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	98.82
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.82
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.82
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.8
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.8
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.8
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.79
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.77
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.74
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.73
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.72
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.71
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.71
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.69
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.69
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.68
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.67
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.66
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.66
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.66
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.65
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.64
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.63
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.63
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.63
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.61
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.61
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.61
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.6
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.6
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.59
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.57
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.56
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.55
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.51
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.51
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.51
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.51
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.5
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.5
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.5
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.49
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.48
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.47
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.47
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.47
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.47
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.45
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.45
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.44
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.44
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.44
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.43
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.43
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.43
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.42
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.42
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.38
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.38
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.37
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.36
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.34
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.33
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.33
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.3
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.28
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.28
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.27
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.24
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.24
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.23
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.22
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.2
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.19
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.15
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.13
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.13
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.12
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.11
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.1
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.08
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.03
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.02
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.0
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	97.99
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.99
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.98
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.93
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	97.93
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	97.93
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.9
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.89
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.86
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.8
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.76
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	97.72
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.7
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.69
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.66
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.66
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.59
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.54
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.46
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.44
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.4
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.4
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.37
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.27
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.06
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.97
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.95
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	96.9
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.83
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.02
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	95.97
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	95.82
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.8
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	95.64
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.33
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	94.29
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.2
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	93.61
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	92.5
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	90.17
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	89.86
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	82.15

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

Probab=99.96  E-value=8.4e-27  Score=196.19  Aligned_cols=227  Identities=28%  Similarity=0.424  Sum_probs=138.5

Q ss_pred             CCCCCCCCHHHHHHHcccCChhHHHHHHhcChhHHHhhc--CCCcEEEccCCCCcchHHHHHH-----------------
Q 023680           40 ITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAIC--LGLTHLSLSWCKNNMNNLVLSL-----------------  100 (279)
Q Consensus        40 ~~~~~~Lp~~il~~I~~~L~~~~l~~~~~vc~~w~~~~~--~~l~~l~l~~~~~~~~~~~~~l-----------------  100 (279)
                      ...|.+||+|++.+||+||+.+++.+++.|||+|+.+..  ..|+++++++.... +..+..+                 
T Consensus         6 ~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~-~~~~~~~~~~~l~~L~l~~n~l~~   84 (336)
T 2ast_B            6 GVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLH-PDVTGRLLSQGVIAFRCPRSFMDQ   84 (336)
T ss_dssp             -CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCC-HHHHHHHHHTTCSEEECTTCEECS
T ss_pred             cCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCC-HHHHHhhhhccceEEEcCCccccc
Confidence            467999999999999999999999999999999999874  23677776654322 1222211                 


Q ss_pred             ----cccCCCceEEEeeCCCCCCCHHHHHHHHhhCCCCCeEecCCCCCCCHHHHHHHHhcCCCCCEEEecCCCCCCHHHH
Q 023680          101 ----APKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHAL  176 (279)
Q Consensus       101 ----~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~  176 (279)
                          ...+++|++|+++ .+ .+++..+......+++|++|+++++ .+++.....+.. +++|++|++++|..+++.++
T Consensus        85 ~~~~~~~~~~L~~L~L~-~~-~l~~~~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~~l  160 (336)
T 2ast_B           85 PLAEHFSPFRVQHMDLS-NS-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFAL  160 (336)
T ss_dssp             CCCSCCCCBCCCEEECT-TC-EECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHH
T ss_pred             cchhhccCCCCCEEEcc-CC-CcCHHHHHHHHhhCCCCCEEeCcCc-ccCHHHHHHHhc-CCCCCEEECCCCCCCCHHHH
Confidence                1123556666666 22 3555545555555666666666664 455555554443 56666666666545565555


Q ss_pred             HHHHHcCCCCcEEEcCCCCCCCCHHHHHHHHhcCC-CCCeEeccCCC-CCCHHHHHHHHhcCCCCCEEeccCCCCCChHH
Q 023680          177 AYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCN-QLQSLNLGWCE-DVGDVGVMNLAYGCPDLRSLDLCGCVCITGIS  254 (279)
Q Consensus       177 ~~l~~~~~~L~~L~L~~~~~~~~~~~~~~l~~~~~-~L~~L~l~~~~-~i~~~~l~~l~~~~~~L~~L~l~~c~~i~~~~  254 (279)
                      ..+...+++|++|++++|.. +++.++......++ +|++|++++|. .+++.++..++.++++|++|++++|..+++..
T Consensus       161 ~~~~~~~~~L~~L~l~~~~~-l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~  239 (336)
T 2ast_B          161 QTLLSSCSRLDELNLSWCFD-FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDC  239 (336)
T ss_dssp             HHHHHHCTTCCEEECCCCTT-CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGG
T ss_pred             HHHHhcCCCCCEEcCCCCCC-cChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHH
Confidence            55555666666666666522 55555555445566 66666666654 45655555555566666666666665555555


Q ss_pred             HHHHhhccccCcccccccccccc
Q 023680          255 SADVIIRPSRNCCVVKRECSIGC  277 (279)
Q Consensus       255 ~~~l~~~~~~~c~~~~~~~~~~~  277 (279)
                      +..+     .++++|+.+++.+|
T Consensus       240 ~~~l-----~~l~~L~~L~l~~~  257 (336)
T 2ast_B          240 FQEF-----FQLNYLQHLSLSRC  257 (336)
T ss_dssp             GGGG-----GGCTTCCEEECTTC
T ss_pred             HHHH-----hCCCCCCEeeCCCC
Confidence            5433     33455555555554

PyMOL of 2ast

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		279
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-05
d1fs1a1		41	a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [	2e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.002

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.8 bits (99), Expect = 2e-05
 Identities = 35/196 (17%), Positives = 64/196 (32%), Gaps = 10/196 (5%)

Query: 82  THLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSK 141
             L L+       NL   +  +L     +  R  +  ++    E    S   +Q +DLS 
Sbjct: 3   QTLDLTG-----KNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHF--SPFRVQHMDLSN 55

Query: 142 SFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDY 201
           S  +   +L+ +   C  L  L++ G    SD  +  L      L  LNL GC   +   
Sbjct: 56  S-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFA 112

Query: 202 ALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITGISSADVIIR 261
               +       +       +       + +A+    +  L+L G       S    ++R
Sbjct: 113 LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVR 172

Query: 262 PSRNCCVVKRECSIGC 277
              N   +    S+  
Sbjct: 173 RCPNLVHLDLSDSVML 188

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		279
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.93
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.88
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.51
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.36
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.33
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.25
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	99.16
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	99.15
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	99.12
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	99.05
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.99
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.57
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.53
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.52
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.51
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.48
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.43
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.42
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.39
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.38
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.32
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.25
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.17
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.1
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.04
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	97.99
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.89
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.8
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.8
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	97.79
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.79
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.79
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.77
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.73
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.45
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.42
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.18
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.11
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.02
d2ifga3		156	High affinity nerve growth factor receptor, N-term	96.62
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	96.59
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	95.92
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	94.75
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	94.59
d2ifga3		156	High affinity nerve growth factor receptor, N-term	94.22
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	94.13
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	92.54
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	90.85
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	89.27

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=5.9e-25  Score=178.67  Aligned_cols=189  Identities=23%  Similarity=0.306  Sum_probs=149.7

Q ss_pred             CCCcEEEccCCCCcchHHHHHHcccCCCceEEEeeCCCCCCCHHHHHHHHhhCCCCCeEecCCCCCCCHHHHHHHHhcCC
Q 023680           79 LGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCP  158 (279)
Q Consensus        79 ~~l~~l~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~l~~l~~~~~  158 (279)
                      ..+++++++++. .....+..+...|++|++|.+. ++ .+++..+..++. +++|++|++++|..+++.++..+++.||
T Consensus        46 ~~L~~LdLs~~~-i~~~~l~~l~~~c~~L~~L~L~-~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~  121 (284)
T d2astb2          46 FRVQHMDLSNSV-IEVSTLHGILSQCSKLQNLSLE-GL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCS  121 (284)
T ss_dssp             BCCCEEECTTCE-ECHHHHHHHHTTBCCCSEEECT-TC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCT
T ss_pred             CCCCEEECCCCc-cCHHHHHHHHHhCCCccccccc-cc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHH
Confidence            357888888763 4455666677788888888888 44 678777777765 7888888888888888888888888888


Q ss_pred             CCCEEEecCCCCCCHHHHHHHH-HcCCCCcEEEcCCCCCCCCHHHHHHHHhcCCCCCeEeccCCCCCCHHHHHHHHhcCC
Q 023680          159 NLTRLNISGCTSFSDHALAYLC-GFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCP  237 (279)
Q Consensus       159 ~L~~L~L~~~~~~~~~~~~~l~-~~~~~L~~L~L~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~l~~l~~~~~  237 (279)
                      +|++|++++|..+++.++.... ..+++|+.|+++++...+++.++..+..++|+|++|++++|..+++.++..+ ..|+
T Consensus       122 ~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l-~~~~  200 (284)
T d2astb2         122 RLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF-FQLN  200 (284)
T ss_dssp             TCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG-GGCT
T ss_pred             hccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhh-cccC
Confidence            8888888888888887776544 4467888888888754578888888888888888888888888888877766 4678


Q ss_pred             CCCEEeccCCCCCChHHHHHHhhccccCcccccccccccc
Q 023680          238 DLRSLDLCGCVCITGISSADVIIRPSRNCCVVKRECSIGC  277 (279)
Q Consensus       238 ~L~~L~l~~c~~i~~~~~~~l~~~~~~~c~~~~~~~~~~~  277 (279)
                      +|++|++++|..+++.++..+     .+||+|+.+++.||
T Consensus       201 ~L~~L~L~~C~~i~~~~l~~L-----~~~~~L~~L~l~~~  235 (284)
T d2astb2         201 YLQHLSLSRCYDIIPETLLEL-----GEIPTLKTLQVFGI  235 (284)
T ss_dssp             TCCEEECTTCTTCCGGGGGGG-----GGCTTCCEEECTTS
T ss_pred             cCCEEECCCCCCCChHHHHHH-----hcCCCCCEEeeeCC
Confidence            888888888888888887665     46888888888887

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure