Citrus Sinensis ID: 023708

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MEARDDTNKLSSKRLTGKVAVITGGARGIGAATAKLFAENGAHIVIADILDELGAALASTIGGRYIHCDVTKEEDVESAVRLAVSWKGQLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILHGIKHAAKAMIEGQRKGSIICTSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIRVNCISPHGVPSEMLVNAYRKYLGKADMKPEEVCKMVRDSGSLLRGRSASIEDVAQAALFLASEEAGFITAHNLVIDGGYTTGTSSMSFIYQ
ccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccEEEEcccccccccccccccc
***************TGKVAVITGGARGIGAATAKLFAENGAHIVIADILDELGAALASTIGGRYIHCDVTKEEDVESAVRLAVSWKGQLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILHGIKHAAKAMIEGQRKGSIICTSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIRVNCISPHGVPSEMLVNAYRKYLGKADMKPEEVCKMVRDSGSLLRGRSASIEDVAQAALFLASEEAGFITAHNLVIDGGYTTGTS*M**I**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEARDDTNKLSSKRLTGKVAVITGGARGIGAATAKLFAENGAHIVIADILDELGAALASTIGGRYIHCDVTKEEDVESAVRLAVSWKGQLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILHGIKHAAKAMIEGQRKGSIICTSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIRVNCISPHGVPSEMLVNAYRKYLGKADMKPEEVCKMVRDSGSLLRGRSASIEDVAQAALFLASEEAGFITAHNLVIDGGYTTGTSSMSFIYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-hydroxybutyrate dehydrogenase type 2 Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. Also acts as a 3-hydroxybutyrate dehydrogenase.probableQ3T046
3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase probableP69166
3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase probableP69167

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BGK, chain A
Confidence level:very confident
Coverage over the Query: 12-271
View the alignment between query and template
View the model in PyMOL