Citrus Sinensis ID: 023732

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MAAAAVAGSLTAHDRRILTALNTGASSLSFVGSGFIVLCYCLFKELRKFSFKLVFFLALSDMLCSFFSIVGDPSKGFFCSAQGYSTHFFCVASFLWTTTIAFTLHRTVVQHKTDVEDLEAMFHLYVWGTSLVVTVVRSFGNDHRHLGVWCWTQTGRTGKAVHFITFYAPLWGAILYNGFTYFQVIRMLNNATRVAVGMSDRAYQFDMKALNRWGYYPLILIGSWAFGTINRIHDFIEPGHKIFWLTFLDVGTAALMVNCNDHIFVLFFFGLSFTEICV
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
**********TAHDRRILTALNTGASSLSFVGSGFIVLCYCLFKELRKFSFKLVFFLALSDMLCSFFSIVGDPSKGFFCSAQGYSTHFFCVASFLWTTTIAFTLHRTVVQHKTDVEDLEAMFHLYVWGTSLVVTVVRSFGNDHRHLGVWCWTQTGRTGKAVHFITFYAPLWGAILYNGFTYFQVIRMLNNATRVAVGMSDRAYQFDMKALNRWGYYPLILIGSWAFGTINRIHDFIEPGHKIFWLTFLDVGTAALMVNCNDHIFVLFFFGLSFTEICV
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAVAGSLTAHDRRILTALNTGASSLSFVGSGFIVLCYCLFKELRKFSFKLVFFLALSDMLCSFFSIVGDPSKGFFCSAQGYSTHFFCVASFLWTTTIAFTLHRTVVQHKTDVEDLEAMFHLYVWGTSLVVTVVRSFGNDHRHLGVWCWTQTGRTGKAVHFITFYAPLWGAILYNGFTYFQVIRMLNNATRVAVGMSDRAYQFDMKALNRWGYYPLILIGSWAFGTINRIHDFIEPGHKIFWLTFLDVGTAALMVNCNDHIFVLFFFGLSFTEICV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G-protein coupled receptor 1 Together with GPA1, may regulate the cell cycle via a signaling cascade that uses phosphatidylinositol-specific phospholipase C (PI-PLC) as an effector and inositol 1,4,5-trisphosphate(IP(3)) as a second messenger. Acts as a negative regulator of GPA1-mediated abscisic acid (ABA) responses in guard cells, and together with GPA1 and GB1 during seed germination and early seedling development. Promotes PI-PLC activity and IP(3) accumulation. Involved in the blue light (BL) signaling. Together with GPA1 and ADT3, required for BL-mediated synthesis of phenylpyruvate and subsequently of phenylalanine (Phe), in etiolated seedlings. Probably involved in cytokinin signal transduction. Plays a positive role in gibberellin- (GA) and brassinosteroid- (BR) regulated seed germination, probably independently of an heterotrimeric G-protein. Mediates seed dormancy abolishion, and promotes seed germination and flowering.probableO04714

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:confident
Coverage over the Query: 11-276
View the alignment between query and template
View the model in PyMOL