Citrus Sinensis ID: 023761


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MASSSLATGTPSASAFSKNSSSLVHYYRNGTVFFRLSSSKPKLRFFAKGSQPSWKCATVVKSQLNEVAFDGSSNASATPAAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQPPAPASMAMMHSPSPPPVMPPTQPAPAPTSSAPSASPAPPASPPSSTAGKSVKSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFVIEP
ccccccccccccccCECcccccccccccccEEEEECccccccccccccccccccccccEEEEcHHHHHccccccccccccccccccccccccccccccccccHHccHHHHHHHHHHHHHccccEEEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEccccEEEEEEEccccccccccccEEEEEEEcccccccccccccEEEcc
**********************LVH**RNGTVFFRLSSSKPKLRFFAKGSQPSWKCATVVKSQLN****************************************FISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEA***********************************************************PPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFVIEP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSLATGTPSASAFSKNSSSLVHYYRNGTVFFRLSSSKPKLRFFAKGSQPSWKCATVVKSQLNEVAFDGSSNASATPAAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQPPAPASMAMMHSPSPPPVMPPTQPAPAPTSSAPSASPAPPASPPSSTAGKSVKSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSGTIVEIIAEDRKPVSVDTPLFVIEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.probableQ42533
Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.probableQ42783

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BDO, chain A
Confidence level:very confident
Coverage over the Query: 201-276
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 194-206
View the alignment between query and template
View the model in PyMOL