Citrus Sinensis ID: 023778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
ccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccEEEEcccccccccccHHHHHHHHHHHHHcccccEEEEcccEEEccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccEEcccccHHHHHHHHHccccccccccHHHHHHccccEEEccccccccccEEEEccccccccccccccccEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHcccEEEEEEc
cccEEEEEEHcccHHHHHHHHHHHHHHcccccHHHHHEEEcccHHHHHHHHHHHHHHccccEEEEcccEEEEEEccccccccEccccHHHHHHHHcccccccEEEEEEEEEEcccccEEEccccccHHHHHHHHHHHcccEEEEEEccccEEcccccccccccccccccHHHHHHHHHHcccccccccHHEHHHccccEEEEEccccccccEEEEcccccccHHHHHHcccEEEEEEcccEEEEEEEccccccccHHHHHHHHHHHHccccEEEEEc
MFQVRNYVSELSYEFIRSTYNFlsnvdsghatesfTDFVVGHGELWSAQMLAAVVRKNgidckwmdtrevlivnptssnqvdpdfseSEKRLEKWfsqspsntiiatgfiastpdnipttlkrdgsdFSAAIMGALLRAHQVtiwtdvdgvysadprkVSEAVILRTLSYQEAWEMSYFganvlhprtiipvmrydipIVIRNifnlsvpgimicrppvdenedeqiidspvkgfatiDNLALVNvegtgmagvpgtaNAIFGAVKDVGANVIMISQ
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLivnptssnqvdpdFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
***VRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVN***************************NTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMI**
MFQ*RNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVD*****QIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSN**************KWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQVRNYVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
P37142 921 Bifunctional aspartokinas N/A no 0.978 0.294 0.782 1e-124
O81852 916 Bifunctional aspartokinas yes no 0.942 0.284 0.789 1e-124
Q9SA18 911 Bifunctional aspartokinas no no 0.895 0.272 0.84 1e-124
P49079 920 Bifunctional aspartokinas N/A no 0.891 0.268 0.808 1e-120
P49080 917 Bifunctional aspartokinas N/A no 0.891 0.269 0.78 1e-116
P27725 819 Bifunctional aspartokinas N/A no 0.844 0.285 0.372 3e-42
P00561 820 Bifunctional aspartokinas N/A no 0.859 0.290 0.382 6e-42
Q57991 473 Probable aspartokinase OS yes no 0.859 0.503 0.398 1e-40
P57290 816 Bifunctional aspartokinas yes no 0.873 0.296 0.335 2e-38
Q8K9U9 814 Bifunctional aspartokinas yes no 0.898 0.305 0.348 6e-36
>sp|P37142|AKH_DAUCA Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic (Fragment) OS=Daucus carota PE=1 SV=1 Back     alignment and function desciption
 Score =  444 bits (1143), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 234/271 (86%)

Query: 7   YVSELSYEFIRSTYNFLSNVDSGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMD 66
           +++ L ++ I       +   +GHATESF+DFVVGHGELWSAQ+L+ V+RKNG DC WMD
Sbjct: 178 FLTRLQHDVITLKAMLRAIYIAGHATESFSDFVVGHGELWSAQLLSFVIRKNGGDCNWMD 237

Query: 67  TREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGS 126
           TR+VL+VNP  SNQVDPD+ ESEKRLEKWFS +   TI+ATGFIASTP NIPTTLKRDGS
Sbjct: 238 TRDVLVVNPAGSNQVDPDYLESEKRLEKWFSSNQCQTIVATGFIASTPQNIPTTLKRDGS 297

Query: 127 DFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHP 186
           DFSAAIMGALLRA QVTIWTDV+GVYSADPRKVSEAV+L+TLSYQEAWEMSYFGANVLHP
Sbjct: 298 DFSAAIMGALLRAGQVTIWTDVNGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHP 357

Query: 187 RTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNV 246
           RTI PVMRYDIPIVIRNIFNLS PG MICR  V E ED   ++S VKGFATIDNLAL+NV
Sbjct: 358 RTINPVMRYDIPIVIRNIFNLSAPGTMICRESVGETEDGLKLESHVKGFATIDNLALINV 417

Query: 247 EGTGMAGVPGTANAIFGAVKDVGANVIMISQ 277
           EGTGMAGVPGTA AIFGAVKDVGANVIMISQ
Sbjct: 418 EGTGMAGVPGTATAIFGAVKDVGANVIMISQ 448





Daucus carota (taxid: 4039)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3
>sp|O81852|AKH2_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SA18|AKH1_ARATH Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=AKHSDH1 PE=1 SV=1 Back     alignment and function description
>sp|P49079|AKH1_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic OS=Zea mays GN=AKHSDH1 PE=2 SV=1 Back     alignment and function description
>sp|P49080|AKH2_MAIZE Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic OS=Zea mays GN=AKHSDH2 PE=2 SV=1 Back     alignment and function description
>sp|P27725|AK1H_SERMA Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Serratia marcescens GN=thrA PE=3 SV=1 Back     alignment and function description
>sp|P00561|AK1H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Escherichia coli (strain K12) GN=thrA PE=1 SV=2 Back     alignment and function description
>sp|Q57991|AK_METJA Probable aspartokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0571 PE=1 SV=1 Back     alignment and function description
>sp|P57290|AKH_BUCAI Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thrA PE=3 SV=1 Back     alignment and function description
>sp|Q8K9U9|AKH_BUCAP Bifunctional aspartokinase/homoserine dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
255569084 920 aspartate kinase, putative [Ricinus comm 0.902 0.271 0.884 1e-129
224145045 829 predicted protein [Populus trichocarpa] 0.895 0.299 0.872 1e-128
224136137 843 predicted protein [Populus trichocarpa] 0.895 0.294 0.864 1e-126
147856217 841 hypothetical protein VITISV_034964 [Viti 0.931 0.306 0.818 1e-125
297740938 871 unnamed protein product [Vitis vinifera] 0.931 0.296 0.818 1e-125
225460063 918 PREDICTED: bifunctional aspartokinase/ho 0.931 0.281 0.818 1e-125
351721667 916 aspartokinase-homoserine dehydrogenase [ 0.902 0.272 0.848 1e-124
297846486 911 AK-HSDH I [Arabidopsis lyrata subsp. lyr 0.895 0.272 0.848 1e-124
357518663 909 Bifunctional aspartokinase/homoserine de 0.902 0.275 0.848 1e-124
357518661 917 Bifunctional aspartokinase/homoserine de 0.898 0.271 0.851 1e-123
>gi|255569084|ref|XP_002525511.1| aspartate kinase, putative [Ricinus communis] gi|223535190|gb|EEF36869.1| aspartate kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/250 (88%), Positives = 234/250 (93%)

Query: 28  SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSE 87
           +GHATESFTDFVVGHGELWSAQML+ VVRK+G DCKWMDTREVLIVNPTSSNQVDPDF E
Sbjct: 198 AGHATESFTDFVVGHGELWSAQMLSYVVRKSGQDCKWMDTREVLIVNPTSSNQVDPDFVE 257

Query: 88  SEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTD 147
           SEKRLE+WF++ P  TI+ATGFIASTP NIPTTLKRDGSDFSAAIMGALLRA QVTIWTD
Sbjct: 258 SEKRLEEWFAKHPCKTIVATGFIASTPQNIPTTLKRDGSDFSAAIMGALLRARQVTIWTD 317

Query: 148 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNL 207
           VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPI+IRNIFNL
Sbjct: 318 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIMIRNIFNL 377

Query: 208 SVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD 267
           + PG MICR   DENED Q ++S VKGFATIDN+ALVNVEGTGMAGVPGTA+AIFGAVKD
Sbjct: 378 ASPGTMICRTSTDENEDCQKLESFVKGFATIDNVALVNVEGTGMAGVPGTASAIFGAVKD 437

Query: 268 VGANVIMISQ 277
           VGANVIMISQ
Sbjct: 438 VGANVIMISQ 447




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224145045|ref|XP_002325506.1| predicted protein [Populus trichocarpa] gi|222862381|gb|EEE99887.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136137|ref|XP_002327390.1| predicted protein [Populus trichocarpa] gi|222835760|gb|EEE74195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147856217|emb|CAN82421.1| hypothetical protein VITISV_034964 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740938|emb|CBI31250.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460063|ref|XP_002271525.1| PREDICTED: bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|351721667|ref|NP_001237473.1| aspartokinase-homoserine dehydrogenase [Glycine max] gi|2970447|gb|AAC05981.1| aspartokinase-homoserine dehydrogenase [Glycine max] Back     alignment and taxonomy information
>gi|297846486|ref|XP_002891124.1| AK-HSDH I [Arabidopsis lyrata subsp. lyrata] gi|297336966|gb|EFH67383.1| AK-HSDH I [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357518663|ref|XP_003629620.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] gi|355523642|gb|AET04096.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357518661|ref|XP_003629619.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] gi|355523641|gb|AET04095.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2133995 916 AK-HSDH II "aspartate kinase-h 0.895 0.270 0.84 2.6e-111
TAIR|locus:2029564 911 AK-HSDH I "aspartate kinase-ho 0.895 0.272 0.844 5.3e-111
UNIPROTKB|P00561 820 thrA "ThrA" [Escherichia coli 0.942 0.318 0.364 8.2e-39
UNIPROTKB|Q9KPK3 825 VC_2364 "Aspartokinase I/homos 0.826 0.277 0.4 2.3e-38
TIGR_CMR|VC_2364 825 VC_2364 "aspartokinase I/homos 0.826 0.277 0.4 2.3e-38
TIGR_CMR|CPS_4291 825 CPS_4291 "aspartokinase/homose 0.826 0.277 0.393 1.3e-37
TIGR_CMR|SO_3415 822 SO_3415 "aspartokinase I/homos 0.830 0.279 0.376 2.2e-34
UNIPROTKB|P08660 449 lysC "LysC" [Escherichia coli 0.844 0.521 0.318 3.4e-29
UNIPROTKB|P00562 810 metL "MetL" [Escherichia coli 0.667 0.228 0.393 4.1e-29
UNIPROTKB|Q9KUW8479 VC_0391 "Aspartokinase" [Vibri 0.624 0.361 0.365 3.3e-26
TAIR|locus:2133995 AK-HSDH II "aspartate kinase-homoserine dehydrogenase ii" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1099 (391.9 bits), Expect = 2.6e-111, P = 2.6e-111
 Identities = 210/250 (84%), Positives = 231/250 (92%)

Query:    28 SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSE 87
             +GHA+ESF+DFV GHGELWSAQML+ VVRK G++CKWMDTR+VLIVNPTSSNQVDPDF E
Sbjct:   196 AGHASESFSDFVAGHGELWSAQMLSYVVRKTGLECKWMDTRDVLIVNPTSSNQVDPDFGE 255

Query:    88 SEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTD 147
             SEKRL+KWFS +PS  IIATGFIASTP NIPTTLKRDGSDFSAAIMGALLRA QVTIWTD
Sbjct:   256 SEKRLDKWFSLNPSKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMGALLRARQVTIWTD 315

Query:   148 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNL 207
             VDGVYSADPRKV+EAVIL+TLSYQEAWEMSYFGANVLHPRTIIPVMRY+IPIVIRNIFNL
Sbjct:   316 VDGVYSADPRKVNEAVILQTLSYQEAWEMSYFGANVLHPRTIIPVMRYNIPIVIRNIFNL 375

Query:   208 SVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD 267
             S PG +IC+PP D+ + +  + +PVKGFATIDNLAL+NVEGTGMAGVPGTA+ IFG VKD
Sbjct:   376 SAPGTIICQPPEDDYDLK--LTTPVKGFATIDNLALINVEGTGMAGVPGTASDIFGCVKD 433

Query:   268 VGANVIMISQ 277
             VGANVIMISQ
Sbjct:   434 VGANVIMISQ 443




GO:0000166 "nucleotide binding" evidence=IEA
GO:0004072 "aspartate kinase activity" evidence=IEA;IDA
GO:0004412 "homoserine dehydrogenase activity" evidence=IEA;IDA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0009067 "aspartate family amino acid biosynthetic process" evidence=IEA;TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
TAIR|locus:2029564 AK-HSDH I "aspartate kinase-homoserine dehydrogenase i" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P00561 thrA "ThrA" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPK3 VC_2364 "Aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2364 VC_2364 "aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4291 CPS_4291 "aspartokinase/homoserine dehydrogenase, threonine-sensitive" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3415 SO_3415 "aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P08660 lysC "LysC" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P00562 metL "MetL" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUW8 VC_0391 "Aspartokinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81852AKH2_ARATH1, ., 1, ., 1, ., 30.78960.94220.2849yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.2LOW CONFIDENCE prediction!
4th Layer2.7.2.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XIX000654
hypothetical protein (829 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_66000196
homoserine kinase (EC-2.7.1.39) (366 aa)
   0.987
eugene3.37950001
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (344 aa)
      0.923
grail3.0035005702
dihydrodipicolinate synthase (EC-4.2.1.52) (363 aa)
      0.922
eugene3.00081272
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (375 aa)
      0.921
eugene3.00100987
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (375 aa)
      0.921
estExt_fgenesh4_pg.C_LG_II1351
dihydrodipicolinate synthase (EC-4.2.1.52) (366 aa)
      0.921
estExt_fgenesh4_pg.C_LG_XVI0748
adenylosuccinate synthase (EC-6.3.4.4); Plays an important role in the de novo pathway of purin [...] (491 aa)
      0.816
estExt_fgenesh4_pm.C_LG_XVIII0241
SubName- Full=Putative uncharacterized protein; (407 aa)
       0.810
estExt_fgenesh4_pg.C_LG_VI1672
aspartate transaminase (EC-2.6.1.1) (449 aa)
       0.807
gw1.XIV.3012.1
aspartate transaminase (EC-2.6.1.1) (403 aa)
       0.806

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
cd04257294 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kina 3e-98
cd04243293 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino 2e-92
PRK09436 819 PRK09436, thrA, bifunctional aspartokinase I/homos 1e-91
COG0527 447 COG0527, LysC, Aspartokinases [Amino acid transpor 2e-84
cd04234227 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfa 2e-76
PRK06291 465 PRK06291, PRK06291, aspartate kinase; Provisional 9e-71
TIGR00657 441 TIGR00657, asp_kinases, aspartate kinase 6e-69
TIGR00656 401 TIGR00656, asp_kin_monofn, aspartate kinase, monof 7e-60
PRK09084 448 PRK09084, PRK09084, aspartate kinase III; Validate 2e-51
cd04258292 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Ami 5e-51
cd04244298 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino 9e-51
PRK09466 810 PRK09466, metL, bifunctional aspartate kinase II/h 3e-46
PRK08961 861 PRK08961, PRK08961, bifunctional aspartate kinase/ 2e-45
cd04259295 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Ki 3e-40
PRK06635 404 PRK06635, PRK06635, aspartate kinase; Reviewed 4e-39
cd04245288 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Ami 8e-37
cd04246239 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino 2e-34
PRK09034 454 PRK09034, PRK09034, aspartate kinase; Reviewed 3e-34
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily 1e-32
PLN02551 521 PLN02551, PLN02551, aspartokinase 2e-31
cd04260244 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino A 5e-31
cd04261239 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino 1e-30
PRK08210403 PRK08210, PRK08210, aspartate kinase I; Reviewed 3e-30
PRK05925440 PRK05925, PRK05925, aspartate kinase; Provisional 3e-28
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 3e-28
PRK08373341 PRK08373, PRK08373, aspartate kinase; Validated 7e-28
cd04247306 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kina 3e-27
PRK07431 587 PRK07431, PRK07431, aspartate kinase; Provisional 3e-27
TIGR02078327 TIGR02078, AspKin_pair, Pyrococcus aspartate kinas 1e-20
PRK08841392 PRK08841, PRK08841, aspartate kinase; Validated 2e-18
cd0492180 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of 1e-13
cd04239229 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase 4e-10
PRK06291465 PRK06291, PRK06291, aspartate kinase; Provisional 9e-09
cd0489265 cd04892, ACT_AK-like_2, ACT domains C-terminal to 1e-08
cd0492466 cd04924, ACT_AK-Arch_2, ACT domains of a monofunct 3e-08
PRK00358231 PRK00358, pyrH, uridylate kinase; Provisional 4e-08
COG0528238 COG0528, PyrH, Uridylate kinase [Nucleotide transp 4e-08
TIGR02075232 TIGR02075, pyrH_bact, uridylate kinase 1e-07
cd04254231 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t 4e-07
cd0486860 cd04868, ACT_AK-like, ACT domains C-terminal to th 1e-06
cd04248304 cd04248, AAK_AK-Ectoine, AAK_AK-Ectoine: Amino Aci 6e-06
PRK14558231 PRK14558, pyrH, uridylate kinase; Provisional 1e-05
TIGR02076221 TIGR02076, pyrH_arch, uridylate kinase, putative 2e-05
cd04253221 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP k 2e-05
PRK09034454 PRK09034, PRK09034, aspartate kinase; Reviewed 2e-04
cd0492266 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the b 5e-04
cd04242251 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-k 6e-04
PRK05429372 PRK05429, PRK05429, gamma-glutamyl kinase; Provisi 9e-04
COG0263369 COG0263, ProB, Glutamate 5-kinase [Amino acid tran 0.001
TIGR01027363 TIGR01027, proB, glutamate 5-kinase 0.001
PRK09084448 PRK09084, PRK09084, aspartate kinase III; Validate 0.002
cd04255262 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD i 0.002
>gnl|CDD|239790 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
 Score =  289 bits (742), Expect = 3e-98
 Identities = 97/187 (51%), Positives = 126/187 (67%), Gaps = 2/187 (1%)

Query: 29  GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSES 88
           G   +S    V+  GE  SA++L+A++ + G+D  W+D RE LIV          D   S
Sbjct: 110 GELPDSIRAKVLSFGERLSARLLSALLNQQGLDAAWIDARE-LIVTDGGYLNAVVDIELS 168

Query: 89  EKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDV 148
           ++R++ WFS +    I+ TGFIAS P    TTL R+GSD+SAAI+ ALL A QV IWTDV
Sbjct: 169 KERIKAWFSSNGK-VIVVTGFIASNPQGETTTLGRNGSDYSAAILAALLDADQVEIWTDV 227

Query: 149 DGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLS 208
           DGVYSADPRKV +A +L +LSYQEA E+SYFGA VLHP+TI PV + +IPI+I+N FN  
Sbjct: 228 DGVYSADPRKVKDARLLPSLSYQEAMELSYFGAKVLHPKTIQPVAKKNIPILIKNTFNPE 287

Query: 209 VPGIMIC 215
            PG +I 
Sbjct: 288 APGTLIS 294


These aspartokinases are found in bacteria (E. coli AKI-HSDHI, ThrA and E. coli AKII-HSDHII, MetL) and higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation. Length = 294

>gnl|CDD|239776 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|223601 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|239767 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>gnl|CDD|235773 PRK06291, PRK06291, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233076 TIGR00657, asp_kinases, aspartate kinase Back     alignment and domain information
>gnl|CDD|233075 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class Back     alignment and domain information
>gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated Back     alignment and domain information
>gnl|CDD|239791 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>gnl|CDD|239777 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>gnl|CDD|236530 PRK09466, metL, bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>gnl|CDD|236358 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>gnl|CDD|239792 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>gnl|CDD|235843 PRK06635, PRK06635, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|239778 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>gnl|CDD|239779 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>gnl|CDD|236364 PRK09034, PRK09034, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|178166 PLN02551, PLN02551, aspartokinase Back     alignment and domain information
>gnl|CDD|239793 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>gnl|CDD|239794 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>gnl|CDD|236188 PRK08210, PRK08210, aspartate kinase I; Reviewed Back     alignment and domain information
>gnl|CDD|235646 PRK05925, PRK05925, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|236250 PRK08373, PRK08373, aspartate kinase; Validated Back     alignment and domain information
>gnl|CDD|239780 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>gnl|CDD|236018 PRK07431, PRK07431, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|131133 TIGR02078, AspKin_pair, Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated Back     alignment and domain information
>gnl|CDD|153193 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|235773 PRK06291, PRK06291, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|153164 cd04892, ACT_AK-like_2, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|153196 cd04924, ACT_AK-Arch_2, ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase Back     alignment and domain information
>gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|153140 cd04868, ACT_AK-like, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|239781 cd04248, AAK_AK-Ectoine, AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|233711 TIGR02076, pyrH_arch, uridylate kinase, putative Back     alignment and domain information
>gnl|CDD|239786 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|236364 PRK09034, PRK09034, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|153194 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|239775 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>gnl|CDD|235460 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|223341 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162163 TIGR01027, proB, glutamate 5-kinase Back     alignment and domain information
>gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated Back     alignment and domain information
>gnl|CDD|239788 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
COG0527 447 LysC Aspartokinases [Amino acid transport and meta 100.0
PLN02551 521 aspartokinase 100.0
PRK09084 448 aspartate kinase III; Validated 100.0
PRK09034 454 aspartate kinase; Reviewed 100.0
PRK06291 465 aspartate kinase; Provisional 100.0
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 100.0
PRK09181 475 aspartate kinase; Validated 100.0
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 100.0
PRK05925 440 aspartate kinase; Provisional 100.0
TIGR00657 441 asp_kinases aspartate kinase. The Lys-sensitive en 100.0
TIGR00656 401 asp_kin_monofn aspartate kinase, monofunctional cl 100.0
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki 100.0
KOG0456 559 consensus Aspartate kinase [Amino acid transport a 100.0
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 100.0
PRK08841 392 aspartate kinase; Validated 100.0
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki 100.0
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa 100.0
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina 100.0
PRK08210403 aspartate kinase I; Reviewed 100.0
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa 100.0
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina 100.0
PRK06635 404 aspartate kinase; Reviewed 100.0
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super 100.0
PRK08373341 aspartate kinase; Validated 100.0
PRK07431 587 aspartate kinase; Provisional 100.0
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S 100.0
TIGR02078327 AspKin_pair Pyrococcus aspartate kinase subunit, p 100.0
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 100.0
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase 100.0
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 100.0
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 100.0
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalyti 99.97
PRK14558231 pyrH uridylate kinase; Provisional 99.95
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik 99.94
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K 99.94
PRK00358231 pyrH uridylate kinase; Provisional 99.93
PF00696242 AA_kinase: Amino acid kinase family Match to Gluta 99.93
PRK14557247 pyrH uridylate kinase; Provisional 99.92
PRK12314266 gamma-glutamyl kinase; Provisional 99.92
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi 99.92
COG0528238 PyrH Uridylate kinase [Nucleotide transport and me 99.92
PRK14556249 pyrH uridylate kinase; Provisional 99.91
TIGR02075233 pyrH_bact uridylate kinase. This protein, also cal 99.91
PRK13402368 gamma-glutamyl kinase; Provisional 99.9
PRK05429372 gamma-glutamyl kinase; Provisional 99.88
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP 99.88
TIGR01027363 proB glutamate 5-kinase. Bacterial ProB proteins h 99.87
TIGR02076221 pyrH_arch uridylate kinase, putative. This family 99.86
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fo 99.85
PRK14058268 acetylglutamate/acetylaminoadipate kinase; Provisi 99.85
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase 99.83
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina 99.81
PRK00942283 acetylglutamate kinase; Provisional 99.81
TIGR00761231 argB acetylglutamate kinase. This model describes 99.8
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate 99.79
PLN02512309 acetylglutamate kinase 99.79
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th 99.79
COG0263369 ProB Glutamate 5-kinase [Amino acid transport and 99.78
CHL00202284 argB acetylglutamate kinase; Provisional 99.78
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina 99.78
PTZ00489264 glutamate 5-kinase; Provisional 99.78
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase 99.77
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 99.77
COG1608252 Predicted archaeal kinase [General function predic 99.69
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport 99.68
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.64
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA 99.57
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot 99.56
PRK12353314 putative amino acid kinase; Reviewed 99.56
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam 99.55
TIGR00746310 arcC carbamate kinase. The seed alignment for this 99.51
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) 99.5
PRK05279441 N-acetylglutamate synthase; Validated 99.48
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.44
PRK12686312 carbamate kinase; Reviewed 99.43
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin 99.41
PRK12454313 carbamate kinase-like carbamoyl phosphate syntheta 99.38
PRK12354307 carbamate kinase; Reviewed 99.37
KOG1154285 consensus Gamma-glutamyl kinase [Amino acid transp 99.31
PRK09411297 carbamate kinase; Reviewed 99.29
PRK12352316 putative carbamate kinase; Reviewed 99.21
PRK04531398 acetylglutamate kinase; Provisional 99.11
PLN02825 515 amino-acid N-acetyltransferase 99.09
COG2054212 Uncharacterized archaeal kinase related to asparto 98.93
COG0549312 ArcC Carbamate kinase [Amino acid transport and me 98.54
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to th 98.2
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela 98.16
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 98.16
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 98.13
cd0491566 ACT_AK-Ectoine_2 ACT domains located C-terminal to 98.1
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspa 98.02
PRK06291465 aspartate kinase; Provisional 98.01
cd0491666 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal 97.96
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 97.95
cd0493378 ACT_AK1-AT_1 ACT domains located C-terminal to the 97.92
PLN02551521 aspartokinase 97.91
cd0491865 ACT_AK1-AT_2 ACT domains located C-terminal to the 97.91
COG0527447 LysC Aspartokinases [Amino acid transport and meta 97.9
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.89
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 97.87
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the 97.85
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter 97.8
PRK09034454 aspartate kinase; Reviewed 97.73
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc 97.71
cd0489062 ACT_AK-like_1 ACT domains found C-terminal to the 97.7
TIGR00657441 asp_kinases aspartate kinase. The Lys-sensitive en 97.69
cd0493663 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- 97.6
PRK06635404 aspartate kinase; Reviewed 97.59
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the cataly 97.57
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 97.56
cd0486860 ACT_AK-like ACT domains C-terminal to the catalyti 97.56
PRK05925440 aspartate kinase; Provisional 97.54
cd0492363 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine- 97.53
PRK09181475 aspartate kinase; Validated 97.48
cd0491764 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal 97.46
PRK08210403 aspartate kinase I; Reviewed 97.43
cd0492063 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AK 97.33
PRK07431587 aspartate kinase; Provisional 97.31
PRK09084448 aspartate kinase III; Validated 97.31
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 97.29
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- 97.04
PRK08841392 aspartate kinase; Validated 96.91
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- 96.89
cd0491467 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimela 96.83
KOG0456559 consensus Aspartate kinase [Amino acid transport a 96.7
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 96.65
KOG2436 520 consensus Acetylglutamate kinase/acetylglutamate s 96.28
COG383090 ACT domain-containing protein [Signal transduction 95.86
cd0491071 ACT_AK-Ectoine_1 ACT domains located C-terminal to 95.43
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 94.94
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 92.59
PRK0019490 hypothetical protein; Validated 91.25
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 90.94
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 90.86
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 90.79
cd0491176 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal 89.93
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 89.79
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 89.29
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 88.25
PRK04435147 hypothetical protein; Provisional 86.37
COG1058255 CinA Predicted nucleotide-utilizing enzyme related 84.39
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 82.67
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 81.95
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 81.62
cd0211660 ACT ACT domains are commonly involved in specifica 80.19
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3.4e-59  Score=447.01  Aligned_cols=241  Identities=41%  Similarity=0.633  Sum_probs=224.9

Q ss_pred             cCCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCCchHHHHHHHHHhhcCCCceEEec
Q 023778           28 SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIAT  107 (277)
Q Consensus        28 ~~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~~~~~~~~i~~~l~~~~~~VpVv~  107 (277)
                      .++++++.+|+++|+||++|+.+++.+|+++|++|.+++++++++.+++.++++.+....+...+..+++  .+.|||++
T Consensus       103 ~~~~~~~~~D~ilS~GE~~Sa~lla~~L~~~Gv~A~~~~~~~~~i~t~~~~~~a~i~~~~~~~~l~~~~~--~~~v~Vv~  180 (447)
T COG0527         103 LGEVSPRERDELLSLGERLSAALLAAALNALGVDARSLDGRQAGIATDSNHGNARILDEDSERRLLRLLE--EGKVPVVA  180 (447)
T ss_pred             ccCCCHHHHHHHHhhchHHHHHHHHHHHHhCCCceEEEchHHceeeecCcccccccchhhhhhhHHHHhc--CCcEEEec
Confidence            3578999999999999999999999999999999999999999999988888877665444333777776  78999999


Q ss_pred             CccccCCCCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCeEEeeeCHHHHHHHHhhcCCcchHH
Q 023778          108 GFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPR  187 (277)
Q Consensus       108 G~i~~~~~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~~i~~is~~e~~~l~~~g~~v~~p~  187 (277)
                      ||+|.+++|+++|||||||||+|++||.+|+|+++.||||||||||+|||++|+|++|++|||+||.||+++|++++||+
T Consensus       181 GF~G~~~~G~~tTLGRGGSD~SA~~laa~l~Ad~~~I~TDVdGI~TaDPRiVp~Ar~i~~isyeEa~ELA~~GAkVLHpr  260 (447)
T COG0527         181 GFQGINEDGETTTLGRGGSDYSAAALAAALGADEVEIWTDVDGVYTADPRIVPDARLLPEISYEEALELAYLGAKVLHPR  260 (447)
T ss_pred             CceeecCCCCEEEeCCCcHHHHHHHHHHHcCCCEEEEEECCCCCccCCCCCCCcceEcCccCHHHHHHHHHCCchhcCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCcEEEEeccCCCCCeeEEeCCCCCCCcchhhccCCceeeEeecCeeEEEEecCCCCCchhHHHHHHHHHHh
Q 023778          188 TIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD  267 (277)
Q Consensus       188 a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~~~~~~~~~~~~~~v~~i~~~~nia~Isvvg~gm~~~~gv~a~if~~L~~  267 (277)
                      |++|+++++||++|+|+++|+.+||+|.+...+       ..+.+++|+.++|+++|++.|.+|...+|+++++|..|++
T Consensus       261 av~pa~~~~Ip~~i~~t~~p~~~GTlI~~~~~~-------~~~~v~gIa~~~~~~~i~v~~~~~~~~~g~~a~vf~~l~~  333 (447)
T COG0527         261 AVEPAMRSGIPLRIKNTFNPDAPGTLITAETES-------DEPVVKGIALDDNVALITVSGPGMNGMVGFAARVFGILAE  333 (447)
T ss_pred             HHHHHHhcCCcEEEEecCCCCCCceEEecCCcC-------CCCceEEEEeCCCeEEEEEEccCccccccHHHHHHHHHHH
Confidence            999999999999999999999999999987543       1268999999999999999999999999999999999999


Q ss_pred             CCCcEEEEeC
Q 023778          268 VGANVIMISQ  277 (277)
Q Consensus       268 ~~I~V~~isq  277 (277)
                      +||+|+||+|
T Consensus       334 ~~i~v~~I~q  343 (447)
T COG0527         334 AGINVDLITQ  343 (447)
T ss_pred             cCCcEEEEEe
Confidence            9999999987



>PLN02551 aspartokinase Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>PRK14558 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families Back     alignment and domain information
>PRK14557 pyrH uridylate kinase; Provisional Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14556 pyrH uridylate kinase; Provisional Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>PLN02512 acetylglutamate kinase Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>PTZ00489 glutamate 5-kinase; Provisional Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>PRK12353 putative amino acid kinase; Reviewed Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>TIGR00746 arcC carbamate kinase Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway Back     alignment and domain information
>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>cd04917 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04920 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>cd04914 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04910 ACT_AK-Ectoine_1 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only] Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2hmf_A 469 Structure Of A Threonine Sensitive Aspartokinase Fr 1e-41
3c1n_C 473 Crystal Structure Of Allosteric Inhibition Threonin 1e-41
2j0x_A 449 Crystal Structure Of E. Coli Aspartokinase Iii In C 3e-26
2cdq_A 510 Crystal Structure Of Arabidopsis Thaliana Aspartate 3e-24
3tvi_A 446 Crystal Structure Of Clostridium Acetobutylicum Asp 4e-18
3l76_A 600 Crystal Structure Of Aspartate Kinase From Synechoc 2e-13
3ab4_A 421 Crystal Structure Of Feedback Inhibition Resistant 2e-13
3aaw_A 421 Crystal Structure Of Aspartate Kinase From Coryneba 2e-13
2ij9_A219 Crystal Structure Of Uridylate Kinase From Archaeog 3e-04
3ek5_A243 Unique Gtp-Binding Pocket And Allostery Of Ump Kina 6e-04
>pdb|2HMF|A Chain A, Structure Of A Threonine Sensitive Aspartokinase From Methanococcus Jannaschii Complexed With Mg-Adp And Aspartate Length = 469 Back     alignment and structure

Iteration: 1

Score = 166 bits (421), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 100/251 (39%), Positives = 138/251 (54%), Gaps = 13/251 (5%) Query: 29 GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSES 88 G T D+++ GE S+ +L+ +R G ++ E I+ + E Sbjct: 114 GELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEV 173 Query: 89 EKRLEKWFSQS--PSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWT 146 ++RL + P + TGFI +T + TTL R GSD+SAA++G L A + IWT Sbjct: 174 KERLLPLLKEGIIP----VVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWT 229 Query: 147 DVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFN 206 DV GVY+ DPR V A + LSY EA E++YFGA VLHPRTI P M IPI+++N F Sbjct: 230 DVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFE 289 Query: 207 LSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVK 266 G +I D ++ DS VK +TI N+AL+N+ G GM GV GTA IF A+ Sbjct: 290 PESEGTLITN-------DMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALG 342 Query: 267 DVGANVIMISQ 277 + NVI+ISQ Sbjct: 343 EEEVNVILISQ 353
>pdb|3C1N|C Chain C, Crystal Structure Of Allosteric Inhibition Threonine-Sensitive Aspartokinase From Methanococcus Jannaschii With L-Threonine Length = 473 Back     alignment and structure
>pdb|2J0X|A Chain A, Crystal Structure Of E. Coli Aspartokinase Iii In Complex With Lysine And Aspartate (T-State) Length = 449 Back     alignment and structure
>pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate Kinase Complexed With Lysine And S-Adenosylmethionine Length = 510 Back     alignment and structure
>pdb|3TVI|A Chain A, Crystal Structure Of Clostridium Acetobutylicum Aspartate Kinase (Caak): An Important Allosteric Enzyme For Industrial Amino Acids Production Length = 446 Back     alignment and structure
>pdb|3L76|A Chain A, Crystal Structure Of Aspartate Kinase From Synechocystis Length = 600 Back     alignment and structure
>pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 Back     alignment and structure
>pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 Back     alignment and structure
>pdb|2IJ9|A Chain A, Crystal Structure Of Uridylate Kinase From Archaeoglobus Fulgidus Length = 219 Back     alignment and structure
>pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
3c1m_A 473 Probable aspartokinase; allosteric inhibition, thr 1e-104
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 2e-05
2j0w_A 449 Lysine-sensitive aspartokinase 3; feedback inhibit 2e-99
2j0w_A449 Lysine-sensitive aspartokinase 3; feedback inhibit 1e-05
2cdq_A 510 Aspartokinase; aspartate kinase, amino acid metabo 1e-92
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 7e-04
3tvi_A 446 Aspartokinase; structural genomics, ACT domains, r 7e-92
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibit 6e-36
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase tran 9e-36
3mah_A 157 Aspartokinase; aspartate kinase, structural genomi 2e-11
3mah_A157 Aspartokinase; aspartate kinase, structural genomi 1e-05
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, p 3e-11
2j4j_A226 Uridylate kinase; transferase, nucleoside monophos 5e-11
4a7w_A240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 9e-11
2ogx_B270 Molybdenum storage protein subunit beta; open alph 6e-10
2ogx_A276 Molybdenum storage protein subunit alpha; open alp 2e-09
2ij9_A219 Uridylate kinase; structural genomics, protein str 3e-09
3nwy_A281 Uridylate kinase; allosterically activated form, A 4e-09
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine bi 2e-08
3ek6_A243 Uridylate kinase; UMPK unique GTP B site, alloster 2e-08
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, 2e-07
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genom 3e-07
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, 2e-06
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthe 7e-06
3ll5_A249 Gamma-glutamyl kinase related protein; alternate m 4e-05
2j5v_A367 Glutamate 5-kinase; proline biosynthesis, gamma gl 8e-04
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Length = 446 Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Length = 421 Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Length = 600 Back     alignment and structure
>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Length = 157 Back     alignment and structure
>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Length = 157 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Length = 367 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
2cdq_A 510 Aspartokinase; aspartate kinase, amino acid metabo 100.0
3c1m_A 473 Probable aspartokinase; allosteric inhibition, thr 100.0
3tvi_A 446 Aspartokinase; structural genomics, ACT domains, r 100.0
2j0w_A 449 Lysine-sensitive aspartokinase 3; feedback inhibit 100.0
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibit 100.0
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase tran 100.0
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.93
3ek6_A243 Uridylate kinase; UMPK unique GTP B site, alloster 99.92
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, 99.92
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, 99.92
2j4j_A226 Uridylate kinase; transferase, nucleoside monophos 99.92
4a7w_A240 Uridylate kinase; transferase; HET: GTP; 1.80A {He 99.92
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genom 99.91
2ap9_A299 NAG kinase, acetylglutamate kinase, AGK; structura 99.91
2j5v_A367 Glutamate 5-kinase; proline biosynthesis, gamma gl 99.91
3nwy_A281 Uridylate kinase; allosterically activated form, A 99.9
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthe 99.89
2ogx_A276 Molybdenum storage protein subunit alpha; open alp 99.89
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, p 99.89
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine bi 99.88
2egx_A269 Putative acetylglutamate kinase; struc genomics, N 99.88
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, prot 99.88
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, k 99.87
2ij9_A219 Uridylate kinase; structural genomics, protein str 99.87
2rd5_A298 Acetylglutamate kinase-like protein; protein-prote 99.86
1gs5_A258 Acetylglutamate kinase; carbamate kinase, amino ac 99.86
2v5h_A321 Acetylglutamate kinase; amino-acid biosynthesis, t 99.85
2ogx_B270 Molybdenum storage protein subunit beta; open alph 99.85
2bty_A282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 99.84
3ll5_A249 Gamma-glutamyl kinase related protein; alternate m 99.82
2buf_A300 Acetylglutamate kinase; acetyglutamate kinase, ADP 99.82
3l86_A279 Acetylglutamate kinase; ARGB, amino-acid biosynthe 99.8
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetas 99.8
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinas 99.76
2e9y_A316 Carbamate kinase; transferase, structural genomics 99.72
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.7
3zzh_A307 Acetylglutamate kinase; transferase, arginine bios 99.69
2we5_A310 Carbamate kinase 1; arginine catabolism, arginine 99.67
4ab7_A 464 Protein Arg5,6, mitochondrial; transferase, argini 99.65
3kzf_A317 Carbamate kinase; arginine dihydrolase pathway, gi 99.62
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 99.61
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 99.5
4axs_A332 Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm 99.34
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 98.69
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 98.59
4go7_X 200 Aspartokinase; transferase; 2.00A {Mycobacterium t 98.53
3mah_A 157 Aspartokinase; aspartate kinase, structural genomi 98.53
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 98.46
2re1_A167 Aspartokinase, alpha and beta subunits; structural 98.32
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 98.31
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 98.15
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 98.14
2re1_A 167 Aspartokinase, alpha and beta subunits; structural 98.09
3mah_A157 Aspartokinase; aspartate kinase, structural genomi 98.08
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 98.01
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 97.92
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 97.8
2j0w_A449 Lysine-sensitive aspartokinase 3; feedback inhibit 97.42
2f06_A144 Conserved hypothetical protein; structural genomic 96.51
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 89.11
3kbq_A172 Protein TA0487; structural genomics, CINA, protein 82.37
2nyi_A195 Unknown protein; protein structure initiative, PSI 81.89
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 81.53
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure
Probab=100.00  E-value=2.7e-52  Score=405.58  Aligned_cols=255  Identities=27%  Similarity=0.466  Sum_probs=227.8

Q ss_pred             HHHHHHHHHHHhhhc-----CCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCC---c
Q 023778           14 EFIRSTYNFLSNVDS-----GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPD---F   85 (277)
Q Consensus        14 ~~i~~~~~~L~~~~~-----~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~---~   85 (277)
                      +.++..++.|++++.     ++++++.+|+++|+||++|+.+++.+|+++|++|+++++.++.+++++.+++.+++   +
T Consensus       113 ~~i~~~~~~l~~~l~~~~~~~~~~~r~~d~l~s~GE~~s~~ll~~~L~~~Gi~A~~l~~~~~~l~t~~~~~~~~i~~~~~  192 (510)
T 2cdq_A          113 SVILTYLEELEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATY  192 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEECGGGTTCEECSCSTTCCBCTTHH
T ss_pred             HHHHHHHHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEhhHeeEEEecCCCccchhhHHH
Confidence            456677777777653     47889999999999999999999999999999999999999955666667665543   2


Q ss_pred             hHHHHHHHH-HhhcCCCceEEecCccccCC-CCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCe
Q 023778           86 SESEKRLEK-WFSQSPSNTIIATGFIASTP-DNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAV  163 (277)
Q Consensus        86 ~~~~~~i~~-~l~~~~~~VpVv~G~i~~~~-~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~  163 (277)
                      ....+.+.+ +++  .+.|||++||+|.++ +|.++|+||||||++|+++|.+|+|+++++||||||||++|||.+|+|+
T Consensus       193 ~~~~~~l~~~Ll~--~g~IpVv~Gf~g~~~~~g~ittlgrGgsD~tAa~lA~~l~Ad~l~i~TDVdGVytaDPr~v~~A~  270 (510)
T 2cdq_A          193 PAVAKRLYDDWMH--DPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRAT  270 (510)
T ss_dssp             HHHHHHHHHHHHH--SCCEEEEESSEEEETTTCCEEECCTTHHHHHHHHHHHHHTCSEEEEEESSSSSBSSCTTTCTTCC
T ss_pred             HHHHHHHHHHHHh--CCcEEEEeCccccCCCCCceEEeCCCChHHHHHHHHHHcCCCEEEEEeCCCCcCCCCCCCCCCCE
Confidence            223455554 556  789999999999998 9999999999999999999999999999999999999999999999999


Q ss_pred             EEeeeCHHHHHHHHhhcCCcchHHHHHHHHhCCCcEEEEeccCCCCCeeEEeCCCCCCCcchhhccCCceeeEeecCeeE
Q 023778          164 ILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLAL  243 (277)
Q Consensus       164 ~i~~is~~e~~~l~~~g~~v~~p~a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~~~~~~~~~~~~~~v~~i~~~~nia~  243 (277)
                      +|++++|+|+.+|+++|+++|||+|+++|.++|||++|+|+++|+.+||+|.+....       ..+.+++|+.++|+++
T Consensus       271 ~I~~Is~~E~~ela~~Ga~vmh~~a~~~a~~~gIpv~I~n~~~p~~~GT~I~~~~~~-------~~~~v~gIa~~~~~~~  343 (510)
T 2cdq_A          271 PVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDM-------TKSILTSIVLKRNVTM  343 (510)
T ss_dssp             BCCEEEHHHHHHHHHHHSSCCCHHHHHHHHHHTCCEEEEETTSTTSCCEEEESCCCC-------TTCCEEEEEEEEEEEE
T ss_pred             EecEeCHHHHHHHHhcCcchhHHHHHHHHHHCCCeEEEEccCcCCCCCeEEeccccc-------cccccccccccCCeEE
Confidence            999999999999999999999999999999999999999999999999999875421       2347999999999999


Q ss_pred             EEEecCCCCCchhHHHHHHHHHHhCCCcEEEEeC
Q 023778          244 VNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ  277 (277)
Q Consensus       244 Isvvg~gm~~~~gv~a~if~~L~~~~I~V~~isq  277 (277)
                      |+|.|.+|.+.+||++++|+.|+++||+|+||+|
T Consensus       344 I~i~~~~m~~~~g~~~~if~~la~~~I~vd~I~s  377 (510)
T 2cdq_A          344 LDIASTRMLGQVGFLAKVFSIFEELGISVDVVAT  377 (510)
T ss_dssp             EEEECGGGTTCTTHHHHHHHHHHHTTCCEEEEEE
T ss_pred             EEEEcCCCCCcccHHHHHHHHHHHcCCcEEEEEe
Confidence            9999999999999999999999999999999975



>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d2j0wa1292 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli 1e-41
d2cdqa1304 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Ar 3e-38
d2hmfa1302 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus ja 7e-36
d2a1fa1236 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi 2e-10
d2cdqa291 d.58.18.10 (A:329-419) Aspartokinase {Thale cress 6e-10
d2hmfa3100 d.58.18.10 (A:304-403) Aspartokinase {Methanococcu 1e-09
d2ij9a1219 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog 2e-09
d2j0wa291 d.58.18.10 (A:295-385) Aspartokinase {Escherichia 5e-09
d1ybda1236 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri 7e-08
d2hmfa267 d.58.18.10 (A:404-470) Aspartokinase {Methanococcu 1e-06
d2j0wa364 d.58.18.10 (A:386-449) Aspartokinase {Escherichia 5e-06
d2brxa1225 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc 2e-05
d1z9da1238 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc 4e-05
d2cdqa375 d.58.18.10 (A:420-494) Aspartokinase {Thale cress 0.002
>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Aspartokinase
species: Escherichia coli [TaxId: 562]
 Score =  142 bits (359), Expect = 1e-41
 Identities = 66/194 (34%), Positives = 104/194 (53%), Gaps = 6/194 (3%)

Query: 32  TESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKR 91
           + + TD +V HGEL S  +   ++R+  +  +W D R+V+  N           + +E  
Sbjct: 105 SPALTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELA 164

Query: 92  LEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGV 151
             +   +     +I  GFI S      TTL R GSD++AA++   L A +V IWTDV G+
Sbjct: 165 ALQLLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGI 224

Query: 152 YSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPG 211
           Y+ DPR VS A  +  +++ EA EM+ FGA VLHP T++P +R DIP+ + +  +    G
Sbjct: 225 YTTDPRVVSAAKRIDEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGG 284

Query: 212 IMICRPPVDENEDE 225
            ++C      N+ E
Sbjct: 285 TLVC------NKTE 292


>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 304 Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 302 Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 91 Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 100 Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 Back     information, alignment and structure
>d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 91 Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 67 Back     information, alignment and structure
>d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 64 Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 Back     information, alignment and structure
>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d2cdqa1304 Aspartokinase {Thale cress (Arabidopsis thaliana) 100.0
d2j0wa1292 Aspartokinase {Escherichia coli [TaxId: 562]} 100.0
d2hmfa1302 Aspartokinase {Methanococcus jannaschii [TaxId: 21 100.0
d2brxa1225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 99.89
d2akoa1250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 99.88
d2a1fa1236 Uridylate kinase PyrH {Haemophilus influenzae [Tax 99.87
d2ij9a1219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 99.86
d1ybda1236 Uridylate kinase PyrH {Neisseria meningitidis [Tax 99.84
d1z9da1238 Uridylate kinase PyrH {Streptococcus pyogenes [Tax 99.73
d2bufa1300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginos 99.65
d2btya1282 N-acetyl-l-glutamate kinase {Thermotoga maritima [ 99.64
d2ap9a1291 N-acetyl-l-glutamate kinase {Mycobacterium tubercu 99.62
d1e19a_313 Carbamate kinase {Archaeon Pyrococcus furiosus [Ta 99.41
d1b7ba_307 Carbamate kinase {Enterococcus faecium [TaxId: 135 99.38
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 99.09
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 99.02
d2j0wa291 Aspartokinase {Escherichia coli [TaxId: 562]} 98.88
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 98.75
d1gs5a_258 N-acetyl-l-glutamate kinase {Escherichia coli [Tax 98.68
d2cdqa375 Aspartokinase {Thale cress (Arabidopsis thaliana) 98.43
d2j0wa364 Aspartokinase {Escherichia coli [TaxId: 562]} 97.87
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 93.86
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 92.38
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 91.8
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 87.86
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 85.95
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 85.06
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 82.98
d1zhva266 Hypothetical protein Atu0741 {Agrobacterium tumefa 82.63
>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: PyrH-like
domain: Aspartokinase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00  E-value=2.5e-52  Score=380.58  Aligned_cols=203  Identities=29%  Similarity=0.483  Sum_probs=184.0

Q ss_pred             HHHHHHHHHHHhhhc-----CCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCCchHH
Q 023778           14 EFIRSTYNFLSNVDS-----GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSES   88 (277)
Q Consensus        14 ~~i~~~~~~L~~~~~-----~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~~~~~   88 (277)
                      +.+.+.+++|+++++     ++++++.+|+++|+||+||+.+++++|++.|+++.++|++++++++++++++++++...+
T Consensus        89 ~~~~~~~~~l~~~l~~i~~~~~~s~~~~D~ils~GE~lSa~ll~~~L~~~gi~a~~~d~~~~~iit~~~~~~a~~~~~~~  168 (304)
T d2cdqa1          89 SVILTYLEELEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATY  168 (304)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEECGGGTTCEECSCSTTCCBCTTHH
T ss_pred             hHHHHHHHHHHHHHhhhccccccchhhHHHHHHhHHHHHHHHHHHHHHHcCCceEEEeecccccccccccccccccccch
Confidence            456677777877776     589999999999999999999999999999999999999998777888888877765444


Q ss_pred             HHH----HHHHhhcCCCceEEecCccccC-CCCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCe
Q 023778           89 EKR----LEKWFSQSPSNTIIATGFIAST-PDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAV  163 (277)
Q Consensus        89 ~~~----i~~~l~~~~~~VpVv~G~i~~~-~~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~  163 (277)
                      ...    +..+++  .+.|||++||+|.+ ++|+++|||||||||+|+++|.+|+|++++||||||||||+|||.+++|+
T Consensus       169 ~~~~~~~~~~~~~--~~~v~vv~Gfig~~~~~G~~ttLGRgGSD~TAa~la~~l~A~~~~iwtDV~Gi~taDPr~v~~a~  246 (304)
T d2cdqa1         169 PAVAKRLYDDWMH--DPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRAT  246 (304)
T ss_dssp             HHHHHHHHHHHHH--SCCEEEEESSEEEETTTCCEEECCTTHHHHHHHHHHHHHTCSEEEEEESSSSSBSSCTTTCTTCC
T ss_pred             hhhHHHHhhhhhc--cCcEEEeeccccccCcCCceeeeccCccccHHHHHHHHhCchHHHHhcCcchheeccccccCCce
Confidence            433    334455  67899999999997 78999999999999999999999999999999999999999999999999


Q ss_pred             EEeeeCHHHHHHHHhhcCCcchHHHHHHHHhCCCcEEEEeccCCCCCeeEEeCCC
Q 023778          164 ILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPP  218 (277)
Q Consensus       164 ~i~~is~~e~~~l~~~g~~v~~p~a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~  218 (277)
                      +|++|||+||.||+++|++++||+|+.|+++++||++|+|+++|+.+||+|+++.
T Consensus       247 ~i~~lsy~EA~ela~~GakvlHp~ti~p~~~~~Ipi~i~nt~~p~~~GT~I~~~~  301 (304)
T d2cdqa1         247 PVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTR  301 (304)
T ss_dssp             BCCEEEHHHHHHHHHHHSSCCCHHHHHHHHHHTCCEEEEETTSTTSCCEEEESCC
T ss_pred             EcCccCHHHHHHHHhCCCcccCHHHHHHHHHCCCcEEEecCCCCCCCCCEEeCCC
Confidence            9999999999999999999999999999999999999999999999999998653



>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure