Citrus Sinensis ID: 023782
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 277 | ||||||
| 255569084 | 920 | aspartate kinase, putative [Ricinus comm | 0.902 | 0.271 | 0.884 | 1e-129 | |
| 224145045 | 829 | predicted protein [Populus trichocarpa] | 0.895 | 0.299 | 0.872 | 1e-128 | |
| 224136137 | 843 | predicted protein [Populus trichocarpa] | 0.895 | 0.294 | 0.864 | 1e-126 | |
| 147856217 | 841 | hypothetical protein VITISV_034964 [Viti | 0.931 | 0.306 | 0.818 | 1e-125 | |
| 297740938 | 871 | unnamed protein product [Vitis vinifera] | 0.931 | 0.296 | 0.818 | 1e-125 | |
| 225460063 | 918 | PREDICTED: bifunctional aspartokinase/ho | 0.931 | 0.281 | 0.818 | 1e-125 | |
| 351721667 | 916 | aspartokinase-homoserine dehydrogenase [ | 0.902 | 0.272 | 0.848 | 1e-124 | |
| 297846486 | 911 | AK-HSDH I [Arabidopsis lyrata subsp. lyr | 0.895 | 0.272 | 0.848 | 1e-124 | |
| 357518663 | 909 | Bifunctional aspartokinase/homoserine de | 0.902 | 0.275 | 0.848 | 1e-124 | |
| 357518661 | 917 | Bifunctional aspartokinase/homoserine de | 0.898 | 0.271 | 0.851 | 1e-123 |
| >gi|255569084|ref|XP_002525511.1| aspartate kinase, putative [Ricinus communis] gi|223535190|gb|EEF36869.1| aspartate kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 468 bits (1204), Expect = e-129, Method: Compositional matrix adjust.
Identities = 221/250 (88%), Positives = 234/250 (93%)
Query: 28 SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSE 87
+GHATESFTDFVVGHGELWSAQML+ VVRK+G DCKWMDTREVLIVNPTSSNQVDPDF E
Sbjct: 198 AGHATESFTDFVVGHGELWSAQMLSYVVRKSGQDCKWMDTREVLIVNPTSSNQVDPDFVE 257
Query: 88 SEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTD 147
SEKRLE+WF++ P TI+ATGFIASTP NIPTTLKRDGSDFSAAIMGALLRA QVTIWTD
Sbjct: 258 SEKRLEEWFAKHPCKTIVATGFIASTPQNIPTTLKRDGSDFSAAIMGALLRARQVTIWTD 317
Query: 148 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNL 207
VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPI+IRNIFNL
Sbjct: 318 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIMIRNIFNL 377
Query: 208 SVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD 267
+ PG MICR DENED Q ++S VKGFATIDN+ALVNVEGTGMAGVPGTA+AIFGAVKD
Sbjct: 378 ASPGTMICRTSTDENEDCQKLESFVKGFATIDNVALVNVEGTGMAGVPGTASAIFGAVKD 437
Query: 268 VGANVIMISQ 277
VGANVIMISQ
Sbjct: 438 VGANVIMISQ 447
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224145045|ref|XP_002325506.1| predicted protein [Populus trichocarpa] gi|222862381|gb|EEE99887.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224136137|ref|XP_002327390.1| predicted protein [Populus trichocarpa] gi|222835760|gb|EEE74195.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147856217|emb|CAN82421.1| hypothetical protein VITISV_034964 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297740938|emb|CBI31250.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460063|ref|XP_002271525.1| PREDICTED: bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351721667|ref|NP_001237473.1| aspartokinase-homoserine dehydrogenase [Glycine max] gi|2970447|gb|AAC05981.1| aspartokinase-homoserine dehydrogenase [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297846486|ref|XP_002891124.1| AK-HSDH I [Arabidopsis lyrata subsp. lyrata] gi|297336966|gb|EFH67383.1| AK-HSDH I [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357518663|ref|XP_003629620.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] gi|355523642|gb|AET04096.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357518661|ref|XP_003629619.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] gi|355523641|gb|AET04095.1| Bifunctional aspartokinase/homoserine dehydrogenase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 277 | ||||||
| TAIR|locus:2133995 | 916 | AK-HSDH II "aspartate kinase-h | 0.895 | 0.270 | 0.84 | 2.6e-111 | |
| TAIR|locus:2029564 | 911 | AK-HSDH I "aspartate kinase-ho | 0.895 | 0.272 | 0.844 | 5.3e-111 | |
| UNIPROTKB|P00561 | 820 | thrA "ThrA" [Escherichia coli | 0.942 | 0.318 | 0.364 | 8.2e-39 | |
| UNIPROTKB|Q9KPK3 | 825 | VC_2364 "Aspartokinase I/homos | 0.826 | 0.277 | 0.4 | 2.3e-38 | |
| TIGR_CMR|VC_2364 | 825 | VC_2364 "aspartokinase I/homos | 0.826 | 0.277 | 0.4 | 2.3e-38 | |
| TIGR_CMR|CPS_4291 | 825 | CPS_4291 "aspartokinase/homose | 0.826 | 0.277 | 0.393 | 1.3e-37 | |
| TIGR_CMR|SO_3415 | 822 | SO_3415 "aspartokinase I/homos | 0.830 | 0.279 | 0.376 | 2.2e-34 | |
| UNIPROTKB|P08660 | 449 | lysC "LysC" [Escherichia coli | 0.844 | 0.521 | 0.318 | 3.4e-29 | |
| UNIPROTKB|P00562 | 810 | metL "MetL" [Escherichia coli | 0.667 | 0.228 | 0.393 | 4.1e-29 | |
| UNIPROTKB|Q9KUW8 | 479 | VC_0391 "Aspartokinase" [Vibri | 0.624 | 0.361 | 0.365 | 3.3e-26 |
| TAIR|locus:2133995 AK-HSDH II "aspartate kinase-homoserine dehydrogenase ii" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1099 (391.9 bits), Expect = 2.6e-111, P = 2.6e-111
Identities = 210/250 (84%), Positives = 231/250 (92%)
Query: 28 SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSE 87
+GHA+ESF+DFV GHGELWSAQML+ VVRK G++CKWMDTR+VLIVNPTSSNQVDPDF E
Sbjct: 196 AGHASESFSDFVAGHGELWSAQMLSYVVRKTGLECKWMDTRDVLIVNPTSSNQVDPDFGE 255
Query: 88 SEKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTD 147
SEKRL+KWFS +PS IIATGFIASTP NIPTTLKRDGSDFSAAIMGALLRA QVTIWTD
Sbjct: 256 SEKRLDKWFSLNPSKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMGALLRARQVTIWTD 315
Query: 148 VDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNL 207
VDGVYSADPRKV+EAVIL+TLSYQEAWEMSYFGANVLHPRTIIPVMRY+IPIVIRNIFNL
Sbjct: 316 VDGVYSADPRKVNEAVILQTLSYQEAWEMSYFGANVLHPRTIIPVMRYNIPIVIRNIFNL 375
Query: 208 SVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD 267
S PG +IC+PP D+ + + + +PVKGFATIDNLAL+NVEGTGMAGVPGTA+ IFG VKD
Sbjct: 376 SAPGTIICQPPEDDYDLK--LTTPVKGFATIDNLALINVEGTGMAGVPGTASDIFGCVKD 433
Query: 268 VGANVIMISQ 277
VGANVIMISQ
Sbjct: 434 VGANVIMISQ 443
|
|
| TAIR|locus:2029564 AK-HSDH I "aspartate kinase-homoserine dehydrogenase i" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00561 thrA "ThrA" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPK3 VC_2364 "Aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2364 VC_2364 "aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4291 CPS_4291 "aspartokinase/homoserine dehydrogenase, threonine-sensitive" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_3415 SO_3415 "aspartokinase I/homoserine dehydrogenase, threonine-sensitive" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08660 lysC "LysC" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00562 metL "MetL" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KUW8 VC_0391 "Aspartokinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XIX000654 | hypothetical protein (829 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| fgenesh4_pg.C_scaffold_66000196 | • | • | • | • | • | 0.987 | |||||
| eugene3.37950001 | • | • | 0.923 | ||||||||
| grail3.0035005702 | • | • | 0.922 | ||||||||
| eugene3.00081272 | • | • | 0.921 | ||||||||
| eugene3.00100987 | • | • | 0.921 | ||||||||
| estExt_fgenesh4_pg.C_LG_II1351 | • | • | 0.921 | ||||||||
| estExt_fgenesh4_pg.C_LG_XVI0748 | • | • | 0.816 | ||||||||
| estExt_fgenesh4_pm.C_LG_XVIII0241 | • | 0.810 | |||||||||
| estExt_fgenesh4_pg.C_LG_VI1672 | • | 0.807 | |||||||||
| gw1.XIV.3012.1 | • | 0.806 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 277 | |||
| cd04257 | 294 | cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kina | 3e-98 | |
| cd04243 | 293 | cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino | 2e-92 | |
| PRK09436 | 819 | PRK09436, thrA, bifunctional aspartokinase I/homos | 1e-91 | |
| COG0527 | 447 | COG0527, LysC, Aspartokinases [Amino acid transpor | 2e-84 | |
| cd04234 | 227 | cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfa | 2e-76 | |
| PRK06291 | 465 | PRK06291, PRK06291, aspartate kinase; Provisional | 9e-71 | |
| TIGR00657 | 441 | TIGR00657, asp_kinases, aspartate kinase | 6e-69 | |
| TIGR00656 | 401 | TIGR00656, asp_kin_monofn, aspartate kinase, monof | 7e-60 | |
| PRK09084 | 448 | PRK09084, PRK09084, aspartate kinase III; Validate | 2e-51 | |
| cd04258 | 292 | cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Ami | 5e-51 | |
| cd04244 | 298 | cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino | 9e-51 | |
| PRK09466 | 810 | PRK09466, metL, bifunctional aspartate kinase II/h | 3e-46 | |
| PRK08961 | 861 | PRK08961, PRK08961, bifunctional aspartate kinase/ | 2e-45 | |
| cd04259 | 295 | cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Ki | 3e-40 | |
| PRK06635 | 404 | PRK06635, PRK06635, aspartate kinase; Reviewed | 4e-39 | |
| cd04245 | 288 | cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Ami | 8e-37 | |
| cd04246 | 239 | cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino | 2e-34 | |
| PRK09034 | 454 | PRK09034, PRK09034, aspartate kinase; Reviewed | 3e-34 | |
| cd02115 | 248 | cd02115, AAK, Amino Acid Kinases (AAK) superfamily | 1e-32 | |
| PLN02551 | 521 | PLN02551, PLN02551, aspartokinase | 2e-31 | |
| cd04260 | 244 | cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino A | 5e-31 | |
| cd04261 | 239 | cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino | 1e-30 | |
| PRK08210 | 403 | PRK08210, PRK08210, aspartate kinase I; Reviewed | 3e-30 | |
| PRK05925 | 440 | PRK05925, PRK05925, aspartate kinase; Provisional | 3e-28 | |
| pfam00696 | 230 | pfam00696, AA_kinase, Amino acid kinase family | 3e-28 | |
| PRK08373 | 341 | PRK08373, PRK08373, aspartate kinase; Validated | 7e-28 | |
| cd04247 | 306 | cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kina | 3e-27 | |
| PRK07431 | 587 | PRK07431, PRK07431, aspartate kinase; Provisional | 3e-27 | |
| TIGR02078 | 327 | TIGR02078, AspKin_pair, Pyrococcus aspartate kinas | 1e-20 | |
| PRK08841 | 392 | PRK08841, PRK08841, aspartate kinase; Validated | 2e-18 | |
| cd04921 | 80 | cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of | 1e-13 | |
| cd04239 | 229 | cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase | 4e-10 | |
| PRK06291 | 465 | PRK06291, PRK06291, aspartate kinase; Provisional | 9e-09 | |
| cd04892 | 65 | cd04892, ACT_AK-like_2, ACT domains C-terminal to | 1e-08 | |
| cd04924 | 66 | cd04924, ACT_AK-Arch_2, ACT domains of a monofunct | 3e-08 | |
| PRK00358 | 231 | PRK00358, pyrH, uridylate kinase; Provisional | 4e-08 | |
| COG0528 | 238 | COG0528, PyrH, Uridylate kinase [Nucleotide transp | 4e-08 | |
| TIGR02075 | 232 | TIGR02075, pyrH_bact, uridylate kinase | 1e-07 | |
| cd04254 | 231 | cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, t | 4e-07 | |
| cd04868 | 60 | cd04868, ACT_AK-like, ACT domains C-terminal to th | 1e-06 | |
| cd04248 | 304 | cd04248, AAK_AK-Ectoine, AAK_AK-Ectoine: Amino Aci | 6e-06 | |
| PRK14558 | 231 | PRK14558, pyrH, uridylate kinase; Provisional | 1e-05 | |
| TIGR02076 | 221 | TIGR02076, pyrH_arch, uridylate kinase, putative | 2e-05 | |
| cd04253 | 221 | cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP k | 2e-05 | |
| PRK09034 | 454 | PRK09034, PRK09034, aspartate kinase; Reviewed | 2e-04 | |
| cd04922 | 66 | cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the b | 5e-04 | |
| cd04242 | 251 | cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-k | 6e-04 | |
| PRK05429 | 372 | PRK05429, PRK05429, gamma-glutamyl kinase; Provisi | 9e-04 | |
| COG0263 | 369 | COG0263, ProB, Glutamate 5-kinase [Amino acid tran | 0.001 | |
| TIGR01027 | 363 | TIGR01027, proB, glutamate 5-kinase | 0.001 | |
| PRK09084 | 448 | PRK09084, PRK09084, aspartate kinase III; Validate | 0.002 | |
| cd04255 | 262 | cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD i | 0.002 |
| >gnl|CDD|239790 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
Score = 289 bits (742), Expect = 3e-98
Identities = 97/187 (51%), Positives = 126/187 (67%), Gaps = 2/187 (1%)
Query: 29 GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSES 88
G +S V+ GE SA++L+A++ + G+D W+D RE LIV D S
Sbjct: 110 GELPDSIRAKVLSFGERLSARLLSALLNQQGLDAAWIDARE-LIVTDGGYLNAVVDIELS 168
Query: 89 EKRLEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDV 148
++R++ WFS + I+ TGFIAS P TTL R+GSD+SAAI+ ALL A QV IWTDV
Sbjct: 169 KERIKAWFSSNGK-VIVVTGFIASNPQGETTTLGRNGSDYSAAILAALLDADQVEIWTDV 227
Query: 149 DGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLS 208
DGVYSADPRKV +A +L +LSYQEA E+SYFGA VLHP+TI PV + +IPI+I+N FN
Sbjct: 228 DGVYSADPRKVKDARLLPSLSYQEAMELSYFGAKVLHPKTIQPVAKKNIPILIKNTFNPE 287
Query: 209 VPGIMIC 215
PG +I
Sbjct: 288 APGTLIS 294
|
These aspartokinases are found in bacteria (E. coli AKI-HSDHI, ThrA and E. coli AKII-HSDHII, MetL) and higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation. Length = 294 |
| >gnl|CDD|239776 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223601 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239767 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >gnl|CDD|235773 PRK06291, PRK06291, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233076 TIGR00657, asp_kinases, aspartate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|233075 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239791 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >gnl|CDD|239777 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >gnl|CDD|236530 PRK09466, metL, bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236358 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239792 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|235843 PRK06635, PRK06635, aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239778 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >gnl|CDD|239779 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >gnl|CDD|236364 PRK09034, PRK09034, aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239033 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >gnl|CDD|178166 PLN02551, PLN02551, aspartokinase | Back alignment and domain information |
|---|
| >gnl|CDD|239793 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >gnl|CDD|239794 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >gnl|CDD|236188 PRK08210, PRK08210, aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235646 PRK05925, PRK05925, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216067 pfam00696, AA_kinase, Amino acid kinase family | Back alignment and domain information |
|---|
| >gnl|CDD|236250 PRK08373, PRK08373, aspartate kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239780 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains | Back alignment and domain information |
|---|
| >gnl|CDD|236018 PRK07431, PRK07431, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131133 TIGR02078, AspKin_pair, Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|153193 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|239772 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|235773 PRK06291, PRK06291, aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153164 cd04892, ACT_AK-like_2, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|153196 cd04924, ACT_AK-Arch_2, ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
| >gnl|CDD|234735 PRK00358, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223602 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213681 TIGR02075, pyrH_bact, uridylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|239787 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >gnl|CDD|153140 cd04868, ACT_AK-like, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|239781 cd04248, AAK_AK-Ectoine, AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233711 TIGR02076, pyrH_arch, uridylate kinase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|239786 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >gnl|CDD|236364 PRK09034, PRK09034, aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|153194 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >gnl|CDD|239775 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|235460 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223341 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162163 TIGR01027, proB, glutamate 5-kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236376 PRK09084, PRK09084, aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239788 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 100.0 | |
| PLN02551 | 521 | aspartokinase | 100.0 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 100.0 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 100.0 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 100.0 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 100.0 | |
| PRK09181 | 475 | aspartate kinase; Validated | 100.0 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 100.0 | |
| PRK05925 | 440 | aspartate kinase; Provisional | 100.0 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 100.0 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 100.0 | |
| cd04245 | 288 | AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki | 100.0 | |
| KOG0456 | 559 | consensus Aspartate kinase [Amino acid transport a | 100.0 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 100.0 | |
| PRK08841 | 392 | aspartate kinase; Validated | 100.0 | |
| cd04258 | 292 | AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki | 100.0 | |
| cd04257 | 294 | AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa | 100.0 | |
| cd04243 | 293 | AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina | 100.0 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 100.0 | |
| cd04247 | 306 | AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa | 100.0 | |
| cd04244 | 298 | AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina | 100.0 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 100.0 | |
| cd04259 | 295 | AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super | 100.0 | |
| PRK08373 | 341 | aspartate kinase; Validated | 100.0 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 100.0 | |
| cd04248 | 304 | AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S | 100.0 | |
| TIGR02078 | 327 | AspKin_pair Pyrococcus aspartate kinase subunit, p | 100.0 | |
| cd04261 | 239 | AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina | 100.0 | |
| cd04260 | 244 | AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase | 100.0 | |
| cd04234 | 227 | AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) | 100.0 | |
| cd04246 | 239 | AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina | 100.0 | |
| cd02115 | 248 | AAK Amino Acid Kinases (AAK) superfamily, catalyti | 99.97 | |
| PRK14558 | 231 | pyrH uridylate kinase; Provisional | 99.95 | |
| cd04239 | 229 | AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik | 99.94 | |
| cd04242 | 251 | AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K | 99.94 | |
| PRK00358 | 231 | pyrH uridylate kinase; Provisional | 99.93 | |
| PF00696 | 242 | AA_kinase: Amino acid kinase family Match to Gluta | 99.93 | |
| PRK14557 | 247 | pyrH uridylate kinase; Provisional | 99.92 | |
| PRK12314 | 266 | gamma-glutamyl kinase; Provisional | 99.92 | |
| cd04254 | 231 | AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi | 99.92 | |
| COG0528 | 238 | PyrH Uridylate kinase [Nucleotide transport and me | 99.92 | |
| PRK14556 | 249 | pyrH uridylate kinase; Provisional | 99.91 | |
| TIGR02075 | 233 | pyrH_bact uridylate kinase. This protein, also cal | 99.91 | |
| PRK13402 | 368 | gamma-glutamyl kinase; Provisional | 99.9 | |
| PRK05429 | 372 | gamma-glutamyl kinase; Provisional | 99.88 | |
| cd04253 | 221 | AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP | 99.88 | |
| TIGR01027 | 363 | proB glutamate 5-kinase. Bacterial ProB proteins h | 99.87 | |
| TIGR02076 | 221 | pyrH_arch uridylate kinase, putative. This family | 99.86 | |
| cd04241 | 252 | AAK_FomA-like AAK_FomA-like: This CD includes a fo | 99.85 | |
| PRK14058 | 268 | acetylglutamate/acetylaminoadipate kinase; Provisi | 99.85 | |
| cd04250 | 279 | AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase | 99.83 | |
| cd04249 | 252 | AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina | 99.81 | |
| PRK00942 | 283 | acetylglutamate kinase; Provisional | 99.81 | |
| TIGR00761 | 231 | argB acetylglutamate kinase. This model describes | 99.8 | |
| cd04238 | 256 | AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate | 99.79 | |
| PLN02512 | 309 | acetylglutamate kinase | 99.79 | |
| cd04255 | 262 | AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th | 99.79 | |
| COG0263 | 369 | ProB Glutamate 5-kinase [Amino acid transport and | 99.78 | |
| CHL00202 | 284 | argB acetylglutamate kinase; Provisional | 99.78 | |
| cd04251 | 257 | AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina | 99.78 | |
| PTZ00489 | 264 | glutamate 5-kinase; Provisional | 99.78 | |
| cd04256 | 284 | AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase | 99.77 | |
| PLN02418 | 718 | delta-1-pyrroline-5-carboxylate synthase | 99.77 | |
| COG1608 | 252 | Predicted archaeal kinase [General function predic | 99.69 | |
| COG0548 | 265 | ArgB Acetylglutamate kinase [Amino acid transport | 99.68 | |
| TIGR01092 | 715 | P5CS delta l-pyrroline-5-carboxylate synthetase. T | 99.64 | |
| cd04236 | 271 | AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA | 99.57 | |
| cd04235 | 308 | AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot | 99.56 | |
| PRK12353 | 314 | putative amino acid kinase; Reviewed | 99.56 | |
| cd04252 | 248 | AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam | 99.55 | |
| TIGR00746 | 310 | arcC carbamate kinase. The seed alignment for this | 99.51 | |
| cd04237 | 280 | AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) | 99.5 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.48 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.44 | |
| PRK12686 | 312 | carbamate kinase; Reviewed | 99.43 | |
| cd04240 | 203 | AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin | 99.41 | |
| PRK12454 | 313 | carbamate kinase-like carbamoyl phosphate syntheta | 99.38 | |
| PRK12354 | 307 | carbamate kinase; Reviewed | 99.37 | |
| KOG1154 | 285 | consensus Gamma-glutamyl kinase [Amino acid transp | 99.31 | |
| PRK09411 | 297 | carbamate kinase; Reviewed | 99.29 | |
| PRK12352 | 316 | putative carbamate kinase; Reviewed | 99.21 | |
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 99.11 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.09 | |
| COG2054 | 212 | Uncharacterized archaeal kinase related to asparto | 98.93 | |
| COG0549 | 312 | ArcC Carbamate kinase [Amino acid transport and me | 98.54 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 98.2 | |
| cd04937 | 64 | ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela | 98.16 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 98.16 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 98.13 | |
| cd04915 | 66 | ACT_AK-Ectoine_2 ACT domains located C-terminal to | 98.1 | |
| cd04924 | 66 | ACT_AK-Arch_2 ACT domains of a monofunctional aspa | 98.02 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 98.01 | |
| cd04916 | 66 | ACT_AKiii-YclM-BS_2 ACT domains located C-terminal | 97.96 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 97.95 | |
| cd04933 | 78 | ACT_AK1-AT_1 ACT domains located C-terminal to the | 97.92 | |
| PLN02551 | 521 | aspartokinase | 97.91 | |
| cd04918 | 65 | ACT_AK1-AT_2 ACT domains located C-terminal to the | 97.91 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 97.9 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 97.89 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 97.87 | |
| cd04934 | 73 | ACT_AK-Hom3_1 CT domains located C-terminal to the | 97.85 | |
| cd04912 | 75 | ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter | 97.8 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 97.73 | |
| cd04921 | 80 | ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc | 97.71 | |
| cd04890 | 62 | ACT_AK-like_1 ACT domains found C-terminal to the | 97.7 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 97.69 | |
| cd04936 | 63 | ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- | 97.6 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 97.59 | |
| cd04892 | 65 | ACT_AK-like_2 ACT domains C-terminal to the cataly | 97.57 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 97.56 | |
| cd04868 | 60 | ACT_AK-like ACT domains C-terminal to the catalyti | 97.56 | |
| PRK05925 | 440 | aspartate kinase; Provisional | 97.54 | |
| cd04923 | 63 | ACT_AK-LysC-DapG-like_2 ACT domains of the lysine- | 97.53 | |
| PRK09181 | 475 | aspartate kinase; Validated | 97.48 | |
| cd04917 | 64 | ACT_AKiii-LysC-EC_2 ACT domains located C-terminal | 97.46 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 97.43 | |
| cd04920 | 63 | ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AK | 97.33 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 97.31 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 97.31 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 97.29 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 97.04 | |
| PRK08841 | 392 | aspartate kinase; Validated | 96.91 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 96.89 | |
| cd04914 | 67 | ACT_AKi-DapG-BS_1 ACT domains of the diaminopimela | 96.83 | |
| KOG0456 | 559 | consensus Aspartate kinase [Amino acid transport a | 96.7 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 96.65 | |
| KOG2436 | 520 | consensus Acetylglutamate kinase/acetylglutamate s | 96.28 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 95.86 | |
| cd04910 | 71 | ACT_AK-Ectoine_1 ACT domains located C-terminal to | 95.43 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 94.94 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 92.59 | |
| PRK00194 | 90 | hypothetical protein; Validated | 91.25 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 90.94 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 90.86 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 90.79 | |
| cd04911 | 76 | ACT_AKiii-YclM-BS_1 ACT domains located C-terminal | 89.93 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 89.79 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 89.29 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 88.25 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 86.37 | |
| COG1058 | 255 | CinA Predicted nucleotide-utilizing enzyme related | 84.39 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 82.67 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 81.95 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 81.62 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 80.19 |
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-59 Score=447.01 Aligned_cols=241 Identities=41% Similarity=0.633 Sum_probs=224.9
Q ss_pred cCCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCCchHHHHHHHHHhhcCCCceEEec
Q 023782 28 SGHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKRLEKWFSQSPSNTIIAT 107 (277)
Q Consensus 28 ~~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~~~~~~~~i~~~l~~~~~~VpVv~ 107 (277)
.++++++.+|+++|+||++|+.+++.+|+++|++|.+++++++++.+++.++++.+....+...+..+++ .+.|||++
T Consensus 103 ~~~~~~~~~D~ilS~GE~~Sa~lla~~L~~~Gv~A~~~~~~~~~i~t~~~~~~a~i~~~~~~~~l~~~~~--~~~v~Vv~ 180 (447)
T COG0527 103 LGEVSPRERDELLSLGERLSAALLAAALNALGVDARSLDGRQAGIATDSNHGNARILDEDSERRLLRLLE--EGKVPVVA 180 (447)
T ss_pred ccCCCHHHHHHHHhhchHHHHHHHHHHHHhCCCceEEEchHHceeeecCcccccccchhhhhhhHHHHhc--CCcEEEec
Confidence 3578999999999999999999999999999999999999999999988888877665444333777776 78999999
Q ss_pred CccccCCCCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCeEEeeeCHHHHHHHHhhcCCcchHH
Q 023782 108 GFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPR 187 (277)
Q Consensus 108 G~i~~~~~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~~i~~is~~e~~~l~~~g~~v~~p~ 187 (277)
||+|.+++|+++|||||||||+|++||.+|+|+++.||||||||||+|||++|+|++|++|||+||.||+++|++++||+
T Consensus 181 GF~G~~~~G~~tTLGRGGSD~SA~~laa~l~Ad~~~I~TDVdGI~TaDPRiVp~Ar~i~~isyeEa~ELA~~GAkVLHpr 260 (447)
T COG0527 181 GFQGINEDGETTTLGRGGSDYSAAALAAALGADEVEIWTDVDGVYTADPRIVPDARLLPEISYEEALELAYLGAKVLHPR 260 (447)
T ss_pred CceeecCCCCEEEeCCCcHHHHHHHHHHHcCCCEEEEEECCCCCccCCCCCCCcceEcCccCHHHHHHHHHCCchhcCHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhCCCcEEEEeccCCCCCeeEEeCCCCCCCcchhhccCCceeeEeecCeeEEEEecCCCCCchhHHHHHHHHHHh
Q 023782 188 TIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLALVNVEGTGMAGVPGTANAIFGAVKD 267 (277)
Q Consensus 188 a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~~~~~~~~~~~~~~v~~i~~~~nia~Isvvg~gm~~~~gv~a~if~~L~~ 267 (277)
|++|+++++||++|+|+++|+.+||+|.+...+ ..+.+++|+.++|+++|++.|.+|...+|+++++|..|++
T Consensus 261 av~pa~~~~Ip~~i~~t~~p~~~GTlI~~~~~~-------~~~~v~gIa~~~~~~~i~v~~~~~~~~~g~~a~vf~~l~~ 333 (447)
T COG0527 261 AVEPAMRSGIPLRIKNTFNPDAPGTLITAETES-------DEPVVKGIALDDNVALITVSGPGMNGMVGFAARVFGILAE 333 (447)
T ss_pred HHHHHHhcCCcEEEEecCCCCCCceEEecCCcC-------CCCceEEEEeCCCeEEEEEEccCccccccHHHHHHHHHHH
Confidence 999999999999999999999999999987543 1268999999999999999999999999999999999999
Q ss_pred CCCcEEEEeC
Q 023782 268 VGANVIMISQ 277 (277)
Q Consensus 268 ~~I~V~~isq 277 (277)
+||+|+||+|
T Consensus 334 ~~i~v~~I~q 343 (447)
T COG0527 334 AGINVDLITQ 343 (447)
T ss_pred cCCcEEEEEe
Confidence 9999999987
|
|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PRK05925 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >PRK08841 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains | Back alignment and domain information |
|---|
| >cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >PRK08373 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria | Back alignment and domain information |
|---|
| >TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >PRK14558 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >PRK00358 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families | Back alignment and domain information |
|---|
| >PRK14557 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12314 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14556 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02075 pyrH_bact uridylate kinase | Back alignment and domain information |
|---|
| >PRK13402 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05429 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >TIGR01027 proB glutamate 5-kinase | Back alignment and domain information |
|---|
| >TIGR02076 pyrH_arch uridylate kinase, putative | Back alignment and domain information |
|---|
| >cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms | Back alignment and domain information |
|---|
| >PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >PRK00942 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00761 argB acetylglutamate kinase | Back alignment and domain information |
|---|
| >cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >PLN02512 acetylglutamate kinase | Back alignment and domain information |
|---|
| >cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00202 argB acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) | Back alignment and domain information |
|---|
| >PTZ00489 glutamate 5-kinase; Provisional | Back alignment and domain information |
|---|
| >cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >PLN02418 delta-1-pyrroline-5-carboxylate synthase | Back alignment and domain information |
|---|
| >COG1608 Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase | Back alignment and domain information |
|---|
| >cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals | Back alignment and domain information |
|---|
| >cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP | Back alignment and domain information |
|---|
| >PRK12353 putative amino acid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) | Back alignment and domain information |
|---|
| >TIGR00746 arcC carbamate kinase | Back alignment and domain information |
|---|
| >cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK12686 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria | Back alignment and domain information |
|---|
| >PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12354 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09411 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK12352 putative carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains | Back alignment and domain information |
|---|
| >cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK05925 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04917 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04920 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >PRK08841 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >cd04914 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >KOG0456 consensus Aspartate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04910 ACT_AK-Ectoine_1 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only] | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 277 | ||||
| 2hmf_A | 469 | Structure Of A Threonine Sensitive Aspartokinase Fr | 1e-41 | ||
| 3c1n_C | 473 | Crystal Structure Of Allosteric Inhibition Threonin | 1e-41 | ||
| 2j0x_A | 449 | Crystal Structure Of E. Coli Aspartokinase Iii In C | 3e-26 | ||
| 2cdq_A | 510 | Crystal Structure Of Arabidopsis Thaliana Aspartate | 3e-24 | ||
| 3tvi_A | 446 | Crystal Structure Of Clostridium Acetobutylicum Asp | 4e-18 | ||
| 3l76_A | 600 | Crystal Structure Of Aspartate Kinase From Synechoc | 2e-13 | ||
| 3ab4_A | 421 | Crystal Structure Of Feedback Inhibition Resistant | 2e-13 | ||
| 3aaw_A | 421 | Crystal Structure Of Aspartate Kinase From Coryneba | 2e-13 | ||
| 2ij9_A | 219 | Crystal Structure Of Uridylate Kinase From Archaeog | 3e-04 | ||
| 3ek5_A | 243 | Unique Gtp-Binding Pocket And Allostery Of Ump Kina | 6e-04 |
| >pdb|2HMF|A Chain A, Structure Of A Threonine Sensitive Aspartokinase From Methanococcus Jannaschii Complexed With Mg-Adp And Aspartate Length = 469 | Back alignment and structure |
|
| >pdb|3C1N|C Chain C, Crystal Structure Of Allosteric Inhibition Threonine-Sensitive Aspartokinase From Methanococcus Jannaschii With L-Threonine Length = 473 | Back alignment and structure |
| >pdb|2J0X|A Chain A, Crystal Structure Of E. Coli Aspartokinase Iii In Complex With Lysine And Aspartate (T-State) Length = 449 | Back alignment and structure |
| >pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate Kinase Complexed With Lysine And S-Adenosylmethionine Length = 510 | Back alignment and structure |
| >pdb|3TVI|A Chain A, Crystal Structure Of Clostridium Acetobutylicum Aspartate Kinase (Caak): An Important Allosteric Enzyme For Industrial Amino Acids Production Length = 446 | Back alignment and structure |
| >pdb|3L76|A Chain A, Crystal Structure Of Aspartate Kinase From Synechocystis Length = 600 | Back alignment and structure |
| >pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 | Back alignment and structure |
| >pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 | Back alignment and structure |
| >pdb|2IJ9|A Chain A, Crystal Structure Of Uridylate Kinase From Archaeoglobus Fulgidus Length = 219 | Back alignment and structure |
| >pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram- Negative Phytopathogen Bacterium Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 277 | |||
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 1e-104 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 2e-05 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 2e-99 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 1e-05 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 1e-92 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 7e-04 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 7e-92 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 6e-36 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 9e-36 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 2e-11 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 1e-05 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 3e-11 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 5e-11 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 9e-11 | |
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 6e-10 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 2e-09 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 3e-09 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 4e-09 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 2e-08 | |
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 2e-08 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 9e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 2e-07 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 3e-07 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 2e-06 | |
| 3ll9_A | 269 | Isopentenyl phosphate kinase; mevalonate biosynthe | 7e-06 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 4e-05 | |
| 2j5v_A | 367 | Glutamate 5-kinase; proline biosynthesis, gamma gl | 8e-04 |
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* Length = 449 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Length = 510 | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Length = 446 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Length = 421 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Length = 600 | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Length = 157 | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} Length = 157 | Back alignment and structure |
|---|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* Length = 240 | Back alignment and structure |
|---|
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 Length = 219 | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 | Back alignment and structure |
|---|
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 | Back alignment and structure |
|---|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 | Back alignment and structure |
|---|
| >3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 | Back alignment and structure |
|---|
| >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Length = 367 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 100.0 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 100.0 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 100.0 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 100.0 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 100.0 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 100.0 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 99.93 | |
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 99.92 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 99.92 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 99.92 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 99.92 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 99.92 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 99.91 | |
| 2ap9_A | 299 | NAG kinase, acetylglutamate kinase, AGK; structura | 99.91 | |
| 2j5v_A | 367 | Glutamate 5-kinase; proline biosynthesis, gamma gl | 99.91 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 99.9 | |
| 3ll9_A | 269 | Isopentenyl phosphate kinase; mevalonate biosynthe | 99.89 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 99.89 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 99.89 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 99.88 | |
| 2egx_A | 269 | Putative acetylglutamate kinase; struc genomics, N | 99.88 | |
| 2ako_A | 251 | Glutamate 5-kinase; structural genomics, PSI, prot | 99.88 | |
| 3d40_A | 286 | FOMA protein; fosfomycin, antibiotic resistance, k | 99.87 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 99.87 | |
| 2rd5_A | 298 | Acetylglutamate kinase-like protein; protein-prote | 99.86 | |
| 1gs5_A | 258 | Acetylglutamate kinase; carbamate kinase, amino ac | 99.86 | |
| 2v5h_A | 321 | Acetylglutamate kinase; amino-acid biosynthesis, t | 99.85 | |
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 99.85 | |
| 2bty_A | 282 | Acetylglutamate kinase; N-acetyl-L-glutamate kinas | 99.84 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 99.82 | |
| 2buf_A | 300 | Acetylglutamate kinase; acetyglutamate kinase, ADP | 99.82 | |
| 3l86_A | 279 | Acetylglutamate kinase; ARGB, amino-acid biosynthe | 99.8 | |
| 1e19_A | 314 | Carbamate kinase-like carbamoylphosphate synthetas | 99.8 | |
| 3k4o_A | 266 | Isopentenyl phosphate kinase; small molecule kinas | 99.76 | |
| 2e9y_A | 316 | Carbamate kinase; transferase, structural genomics | 99.72 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.7 | |
| 3zzh_A | 307 | Acetylglutamate kinase; transferase, arginine bios | 99.69 | |
| 2we5_A | 310 | Carbamate kinase 1; arginine catabolism, arginine | 99.67 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 99.65 | |
| 3kzf_A | 317 | Carbamate kinase; arginine dihydrolase pathway, gi | 99.62 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 99.61 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 99.5 | |
| 4axs_A | 332 | Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm | 99.34 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 98.69 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 98.59 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 98.53 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 98.53 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 98.46 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 98.32 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 98.31 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 98.15 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 98.14 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 98.09 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 98.08 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 98.01 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 97.92 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 97.8 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 97.42 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 96.51 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 89.11 | |
| 3kbq_A | 172 | Protein TA0487; structural genomics, CINA, protein | 82.37 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 81.89 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 81.53 |
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.7e-52 Score=405.58 Aligned_cols=255 Identities=27% Similarity=0.466 Sum_probs=227.8
Q ss_pred HHHHHHHHHHHhhhc-----CCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCC---c
Q 023782 14 EFIRSTYNFLSNVDS-----GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPD---F 85 (277)
Q Consensus 14 ~~i~~~~~~L~~~~~-----~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~---~ 85 (277)
+.++..++.|++++. ++++++.+|+++|+||++|+.+++.+|+++|++|+++++.++.+++++.+++.+++ +
T Consensus 113 ~~i~~~~~~l~~~l~~~~~~~~~~~r~~d~l~s~GE~~s~~ll~~~L~~~Gi~A~~l~~~~~~l~t~~~~~~~~i~~~~~ 192 (510)
T 2cdq_A 113 SVILTYLEELEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATY 192 (510)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEECGGGTTCEECSCSTTCCBCTTHH
T ss_pred HHHHHHHHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEhhHeeEEEecCCCccchhhHHH
Confidence 456677777777653 47889999999999999999999999999999999999999955666667665543 2
Q ss_pred hHHHHHHHH-HhhcCCCceEEecCccccCC-CCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCe
Q 023782 86 SESEKRLEK-WFSQSPSNTIIATGFIASTP-DNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAV 163 (277)
Q Consensus 86 ~~~~~~i~~-~l~~~~~~VpVv~G~i~~~~-~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~ 163 (277)
....+.+.+ +++ .+.|||++||+|.++ +|.++|+||||||++|+++|.+|+|+++++||||||||++|||.+|+|+
T Consensus 193 ~~~~~~l~~~Ll~--~g~IpVv~Gf~g~~~~~g~ittlgrGgsD~tAa~lA~~l~Ad~l~i~TDVdGVytaDPr~v~~A~ 270 (510)
T 2cdq_A 193 PAVAKRLYDDWMH--DPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRAT 270 (510)
T ss_dssp HHHHHHHHHHHHH--SCCEEEEESSEEEETTTCCEEECCTTHHHHHHHHHHHHHTCSEEEEEESSSSSBSSCTTTCTTCC
T ss_pred HHHHHHHHHHHHh--CCcEEEEeCccccCCCCCceEEeCCCChHHHHHHHHHHcCCCEEEEEeCCCCcCCCCCCCCCCCE
Confidence 223455554 556 789999999999998 9999999999999999999999999999999999999999999999999
Q ss_pred EEeeeCHHHHHHHHhhcCCcchHHHHHHHHhCCCcEEEEeccCCCCCeeEEeCCCCCCCcchhhccCCceeeEeecCeeE
Q 023782 164 ILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPPVDENEDEQIIDSPVKGFATIDNLAL 243 (277)
Q Consensus 164 ~i~~is~~e~~~l~~~g~~v~~p~a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~~~~~~~~~~~~~~v~~i~~~~nia~ 243 (277)
+|++++|+|+.+|+++|+++|||+|+++|.++|||++|+|+++|+.+||+|.+.... ..+.+++|+.++|+++
T Consensus 271 ~I~~Is~~E~~ela~~Ga~vmh~~a~~~a~~~gIpv~I~n~~~p~~~GT~I~~~~~~-------~~~~v~gIa~~~~~~~ 343 (510)
T 2cdq_A 271 PVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDM-------TKSILTSIVLKRNVTM 343 (510)
T ss_dssp BCCEEEHHHHHHHHHHHSSCCCHHHHHHHHHHTCCEEEEETTSTTSCCEEEESCCCC-------TTCCEEEEEEEEEEEE
T ss_pred EecEeCHHHHHHHHhcCcchhHHHHHHHHHHCCCeEEEEccCcCCCCCeEEeccccc-------cccccccccccCCeEE
Confidence 999999999999999999999999999999999999999999999999999875421 2347999999999999
Q ss_pred EEEecCCCCCchhHHHHHHHHHHhCCCcEEEEeC
Q 023782 244 VNVEGTGMAGVPGTANAIFGAVKDVGANVIMISQ 277 (277)
Q Consensus 244 Isvvg~gm~~~~gv~a~if~~L~~~~I~V~~isq 277 (277)
|+|.|.+|.+.+||++++|+.|+++||+|+||+|
T Consensus 344 I~i~~~~m~~~~g~~~~if~~la~~~I~vd~I~s 377 (510)
T 2cdq_A 344 LDIASTRMLGQVGFLAKVFSIFEELGISVDVVAT 377 (510)
T ss_dssp EEEECGGGTTCTTHHHHHHHHHHHTTCCEEEEEE
T ss_pred EEEEcCCCCCcccHHHHHHHHHHHcCCcEEEEEe
Confidence 9999999999999999999999999999999975
|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} | Back alignment and structure |
|---|
| >2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* | Back alignment and structure |
|---|
| >2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* | Back alignment and structure |
|---|
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* | Back alignment and structure |
|---|
| >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 | Back alignment and structure |
|---|
| >3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* | Back alignment and structure |
|---|
| >2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* | Back alignment and structure |
|---|
| >2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
| >3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 277 | ||||
| d2j0wa1 | 292 | c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli | 1e-41 | |
| d2cdqa1 | 304 | c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Ar | 3e-38 | |
| d2hmfa1 | 302 | c.73.1.3 (A:2-303) Aspartokinase {Methanococcus ja | 7e-36 | |
| d2a1fa1 | 236 | c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophi | 2e-10 | |
| d2cdqa2 | 91 | d.58.18.10 (A:329-419) Aspartokinase {Thale cress | 6e-10 | |
| d2hmfa3 | 100 | d.58.18.10 (A:304-403) Aspartokinase {Methanococcu | 1e-09 | |
| d2ij9a1 | 219 | c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeog | 2e-09 | |
| d2j0wa2 | 91 | d.58.18.10 (A:295-385) Aspartokinase {Escherichia | 5e-09 | |
| d1ybda1 | 236 | c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseri | 7e-08 | |
| d2hmfa2 | 67 | d.58.18.10 (A:404-470) Aspartokinase {Methanococcu | 1e-06 | |
| d2j0wa3 | 64 | d.58.18.10 (A:386-449) Aspartokinase {Escherichia | 5e-06 | |
| d2brxa1 | 225 | c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococc | 2e-05 | |
| d1z9da1 | 238 | c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptoc | 4e-05 | |
| d2cdqa3 | 75 | d.58.18.10 (A:420-494) Aspartokinase {Thale cress | 0.002 |
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 292 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Carbamate kinase-like superfamily: Carbamate kinase-like family: PyrH-like domain: Aspartokinase species: Escherichia coli [TaxId: 562]
Score = 142 bits (359), Expect = 1e-41
Identities = 66/194 (34%), Positives = 104/194 (53%), Gaps = 6/194 (3%)
Query: 32 TESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSESEKR 91
+ + TD +V HGEL S + ++R+ + +W D R+V+ N + +E
Sbjct: 105 SPALTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELA 164
Query: 92 LEKWFSQSPSNTIIATGFIASTPDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGV 151
+ + +I GFI S TTL R GSD++AA++ L A +V IWTDV G+
Sbjct: 165 ALQLLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGI 224
Query: 152 YSADPRKVSEAVILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPG 211
Y+ DPR VS A + +++ EA EM+ FGA VLHP T++P +R DIP+ + + + G
Sbjct: 225 YTTDPRVVSAAKRIDEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGG 284
Query: 212 IMICRPPVDENEDE 225
++C N+ E
Sbjct: 285 TLVC------NKTE 292
|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 304 | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 302 | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Length = 236 | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 91 | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 100 | Back information, alignment and structure |
|---|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Length = 219 | Back information, alignment and structure |
|---|
| >d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 91 | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Length = 236 | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Length = 67 | Back information, alignment and structure |
|---|
| >d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]} Length = 64 | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Length = 225 | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Length = 238 | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 75 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 277 | |||
| d2cdqa1 | 304 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 100.0 | |
| d2j0wa1 | 292 | Aspartokinase {Escherichia coli [TaxId: 562]} | 100.0 | |
| d2hmfa1 | 302 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 100.0 | |
| d2brxa1 | 225 | Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: | 99.89 | |
| d2akoa1 | 250 | Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 | 99.88 | |
| d2a1fa1 | 236 | Uridylate kinase PyrH {Haemophilus influenzae [Tax | 99.87 | |
| d2ij9a1 | 219 | Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax | 99.86 | |
| d1ybda1 | 236 | Uridylate kinase PyrH {Neisseria meningitidis [Tax | 99.84 | |
| d1z9da1 | 238 | Uridylate kinase PyrH {Streptococcus pyogenes [Tax | 99.73 | |
| d2bufa1 | 300 | N-acetyl-l-glutamate kinase {Pseudomonas aeruginos | 99.65 | |
| d2btya1 | 282 | N-acetyl-l-glutamate kinase {Thermotoga maritima [ | 99.64 | |
| d2ap9a1 | 291 | N-acetyl-l-glutamate kinase {Mycobacterium tubercu | 99.62 | |
| d1e19a_ | 313 | Carbamate kinase {Archaeon Pyrococcus furiosus [Ta | 99.41 | |
| d1b7ba_ | 307 | Carbamate kinase {Enterococcus faecium [TaxId: 135 | 99.38 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 99.09 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 99.02 | |
| d2j0wa2 | 91 | Aspartokinase {Escherichia coli [TaxId: 562]} | 98.88 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 98.75 | |
| d1gs5a_ | 258 | N-acetyl-l-glutamate kinase {Escherichia coli [Tax | 98.68 | |
| d2cdqa3 | 75 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 98.43 | |
| d2j0wa3 | 64 | Aspartokinase {Escherichia coli [TaxId: 562]} | 97.87 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 93.86 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 92.38 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 91.8 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 87.86 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 85.95 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 85.06 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 82.98 | |
| d1zhva2 | 66 | Hypothetical protein Atu0741 {Agrobacterium tumefa | 82.63 |
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Carbamate kinase-like superfamily: Carbamate kinase-like family: PyrH-like domain: Aspartokinase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=2.5e-52 Score=380.58 Aligned_cols=203 Identities=29% Similarity=0.483 Sum_probs=184.0
Q ss_pred HHHHHHHHHHHhhhc-----CCCChhHHHHHhhhcHHHHHHHHHHHHHHCCCCeEEEccccceeecCCCCCCcCCCchHH
Q 023782 14 EFIRSTYNFLSNVDS-----GHATESFTDFVVGHGELWSAQMLAAVVRKNGIDCKWMDTREVLIVNPTSSNQVDPDFSES 88 (277)
Q Consensus 14 ~~i~~~~~~L~~~~~-----~~~~~~~~~~v~s~Ge~~s~~ll~~~L~~~Gi~a~~l~~~~~~~~~~~~~g~~~~~~~~~ 88 (277)
+.+.+.+++|+++++ ++++++.+|+++|+||+||+.+++++|++.|+++.++|++++++++++++++++++...+
T Consensus 89 ~~~~~~~~~l~~~l~~i~~~~~~s~~~~D~ils~GE~lSa~ll~~~L~~~gi~a~~~d~~~~~iit~~~~~~a~~~~~~~ 168 (304)
T d2cdqa1 89 SVILTYLEELEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATY 168 (304)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEECGGGTTCEECSCSTTCCBCTTHH
T ss_pred hHHHHHHHHHHHHHhhhccccccchhhHHHHHHhHHHHHHHHHHHHHHHcCCceEEEeecccccccccccccccccccch
Confidence 456677777877776 589999999999999999999999999999999999999998777888888877765444
Q ss_pred HHH----HHHHhhcCCCceEEecCccccC-CCCCceeccCCCchHHHHHHHHHhCcceEEEeeccccccccCCCCCCCCe
Q 023782 89 EKR----LEKWFSQSPSNTIIATGFIAST-PDNIPTTLKRDGSDFSAAIMGALLRAHQVTIWTDVDGVYSADPRKVSEAV 163 (277)
Q Consensus 89 ~~~----i~~~l~~~~~~VpVv~G~i~~~-~~G~~~~lgrggsD~~A~~lA~~l~A~~l~i~tDV~Gvyt~dP~~~~~a~ 163 (277)
... +..+++ .+.|||++||+|.+ ++|+++|||||||||+|+++|.+|+|++++||||||||||+|||.+++|+
T Consensus 169 ~~~~~~~~~~~~~--~~~v~vv~Gfig~~~~~G~~ttLGRgGSD~TAa~la~~l~A~~~~iwtDV~Gi~taDPr~v~~a~ 246 (304)
T d2cdqa1 169 PAVAKRLYDDWMH--DPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRAT 246 (304)
T ss_dssp HHHHHHHHHHHHH--SCCEEEEESSEEEETTTCCEEECCTTHHHHHHHHHHHHHTCSEEEEEESSSSSBSSCTTTCTTCC
T ss_pred hhhHHHHhhhhhc--cCcEEEeeccccccCcCCceeeeccCccccHHHHHHHHhCchHHHHhcCcchheeccccccCCce
Confidence 433 334455 67899999999997 78999999999999999999999999999999999999999999999999
Q ss_pred EEeeeCHHHHHHHHhhcCCcchHHHHHHHHhCCCcEEEEeccCCCCCeeEEeCCC
Q 023782 164 ILRTLSYQEAWEMSYFGANVLHPRTIIPVMRYDIPIVIRNIFNLSVPGIMICRPP 218 (277)
Q Consensus 164 ~i~~is~~e~~~l~~~g~~v~~p~a~~~a~~~~i~v~I~n~~~~~~~GT~I~~~~ 218 (277)
+|++|||+||.||+++|++++||+|+.|+++++||++|+|+++|+.+||+|+++.
T Consensus 247 ~i~~lsy~EA~ela~~GakvlHp~ti~p~~~~~Ipi~i~nt~~p~~~GT~I~~~~ 301 (304)
T d2cdqa1 247 PVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTR 301 (304)
T ss_dssp BCCEEEHHHHHHHHHHHSSCCCHHHHHHHHHHTCCEEEEETTSTTSCCEEEESCC
T ss_pred EcCccCHHHHHHHHhCCCcccCHHHHHHHHHCCCcEEEecCCCCCCCCCEEeCCC
Confidence 9999999999999999999999999999999999999999999999999998653
|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|