Citrus Sinensis ID: 023783

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------

MFGRMSLSRLSSRTHILPLLQQSRCVKDVLWSNYKYTRVDTSCYASVWGLMPRCGYGSNMTNGYRKPQSFGSGCLWKSNSFSSFQRHYASHASTEQKSRKMLLYLTALVFAMVGSTYAAVPLYRRFCQATGYGGTVQRKETVEEKIARHSKDGTVTTREVVVQFNADVADGMPWKFIPTQREVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED

cccccccccccccccccHHHHccccccccccccccCECcccccEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccCEEEccHHHHHHHHccccccccccEEEEEEEEECccccccEEECcccEEEEcccccEEEEEEECccccccEEEEEEcccccHHHHHHcccEEEEEEcccccccccEEEEEEEEEEccccccccccccccEEEEEEEEEEEccc

*********LSSRTHILPLLQQSRCVKDVLWSNYKYTRVDTSCYASVWGLMPRCGYG******************************************KMLLYLTALVFAMVGSTYAAVPLYRRFCQATGYGGTVQRKETV********KDGTVTTREVVVQFNADVADGMPWKFIPTQREVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKV***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome c oxidase assembly protein COX11, mitochondrial	Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.	probable	Q8GWR0
Cytochrome c oxidase assembly protein COX11, mitochondrial	Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.	probable	A3KMZ6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SO9, chain A
Confidence level:very confident
Coverage over the Query: 139-276
View the alignment between query and template
View the model in PyMOL