Citrus Sinensis ID: 023793


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MSWNSNYFPSSQEGAASVYTMADGSLGDMFGGFLYSAGQQANEAVLGQLSALSFTSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQIIGDSIAFSLGLATTLALLGVGASFAGKAYGQIGTGLPLAASGLAIVMGLNLLEIIELQLPSFFDNFDPRAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVATSKDPLIGGTLLLSYTTGYVAPLLLAASFAGALQSLLSFRKFSSWINPMSGALLLGGGLYTFLDRLFPTTMAM
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
*****************VYTMADGSLGDMFGGFLYSAGQQANEAVLGQLSALSFTSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQIIGDSIAFSLGLATTLALLGVGASFAGKAYGQIGTGLPLAASGLAIVMGLNLLEIIELQLPSFFDNFDPRAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVATSKDPLIGGTLLLSYTTGYVAPLLLAASFAGALQSLLSFRKFSSWINPMSGALLLGGGLYTFLDRLFPTTMAM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWNSNYFPSSQEGAASVYTMADGSLGDMFGGFLYSAGQQANEAVLGQLSALSFTSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQIIGDSIAFSLGLATTLALLGVGASFAGKAYGQIGTGLPLAASGLAIVMGLNLLEIIELQLPSFFDNFDPRAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVATSKDPLIGGTLLLSYTTGYVAPLLLAASFAGALQSLLSFRKFSSWINPMSGALLLGGGLYTFLDRLFPTTMAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c-type biogenesis ccda-like chloroplastic protein Required for the transfer of reducing equivalents from stroma to thylakoid lumen. Involved in the biogenesis of the plastid cytochrome b6f complex by probably transferring reducing equivalents from stromal m-type thioredoxin (Trx-m) to the lumenal thioredoxin HCF164.probableQ9M5P3
Cytochrome c-type biogenesis ccda-like chloroplastic protein 1 Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.probableQ2RAR6
Cytochrome c-type biogenesis ccda-like chloroplastic protein 2 Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.probableQ2QY07

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted