Citrus Sinensis ID: 023812

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------

MEESWGSGYKEYVAGLIAGVATVIVGHPFDTVKVKLQKHNTEVHGIRYKNGLHCTARILRTEGVRGLYRGATPSFLGMAFESSLLFGIYSQTKQLLQGGVQSGGPQPNVIIPSAAFGGSIISFVLCPSELVKCRMQVQGTDSLVPKSVRYTSPLDCALRTVKQEGVMAIFRGGSTTFLREAIGNAVFFSVYEHVRYYMHLKLKAASSDHSNLIDMGIGIVSGGLGGVAVSILTALHFYFFLLCFSFTLILFYLLCFLVLVSCSTFGCCKNHYPDCSR

cccccccHHHHHHHHHHHHHHHHHHcccccHHHHccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccEEHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccc

*****GSGYKEYVAGLIAGVATVIVGHPFDTVKVKLQKHNTEVHGIRYKNGLHCTARILRTEGVRGLYRGATPSFLGMAFESSLLFGIYSQTKQLLQGGVQSGGPQPNVIIPSAAFGGSIISFVLCPSELVKCRMQVQGTDSLVPKSVRYTSPLDCALRTVKQEGVMAIFRGGSTTFLREAIGNAVFFSVYEHVRYYMHLKLKAASSDHSNLIDMGIGIVSGGLGGVAVSILTALHFYFFLLCFSFTLILFYLLCFLVLVSCSTFGCCKNHYPDC**

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial arginine transporter BAC1	Mitochondrial arginine transporter that catalyzes the counter-exchange of arginine with lysine, ornithine, arginine and histidine. Substrate preference in reconstituted proteoliposomes is arginine > lysine > ornithine > histidine. May be involved in the delivery of arginine, released from seed reserves, to mitochondrial arginase and the export of ornithine.	probable	Q84UC7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 10-239
View the alignment between query and template
View the model in PyMOL