Citrus Sinensis ID: 023822

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MVGSQSEREDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGRVSPFSS
cEEEccccccEEEEEEcHHHcccEEEEEEEccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEECccCEEEEEccccEEEEEEcccEEEEEEcccccccccEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEECccccccccEEEEEEcccccEEEECccccccc
*******REDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGRVSPF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGSQSEREDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGRVSPFSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 82 Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus.probableQ6NV31
WD repeat-containing protein 82 Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus.probableQ5ZMV7
WD repeat-containing protein 82 Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.probableQ6UXN9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 25-275
View the alignment between query and template
View the model in PyMOL