Citrus Sinensis ID: 023823


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MRGLGRLLQRGLSSHRQRPGFPKQNDAVVYAYSRTLSYLSNPITSQNSTLLKSIPLSSSVQSGKWNLFRVQRRTMFIQTQPTPNPSSLMFYPGKPVMEVGSADFPNARAAMNSPLAKSLYGVDGITRVFFGSDFITVTKSEDTSWDLLKPEIFAAIMDFYSSGQPLFLDSETAAAKDTAINEDDSETVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGTVKLRMQGACSGCPSSSVTLKSGIENMLMHYVPEVKSVEQELDAEDEVATLAGQME
cccHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccCCccccccccccccHHHHHccccCEEEEEcccEEEEEcccccccccccHHHHHHHHHHHHccccccccccHHcccccccccccHHHHHHHHHHHHHccccHHHcccccEEEEEECccccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHcccc
**************************AVVYAYSRTLSYLSNPI*****************QSGKWNLFRVQRRTMFIQTQPTPNPSSLMFYPGKPVMEVGSADFPNARAAMNSPLAKSLYGVDGITRVFFGSDFITVTKSEDTSWDLLKPEIFAAIMDFYSSGQPLFLDSE***********DDSETVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGTVKLRMQGACSGCPSSSVTLKSGIENMLMHYVPEVKSVEQELDAED**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGLGRLLQRGLSSHRQRPGFPKQNDAVVYAYSRTLSYLSNPITSQNSTLLKSIPLSSSVQSGKWNLFRVQRRTMFIQTQPTPNPSSLMFYPGKPVMEVGSADFPNARAAMNSPLAKSLYGVDGITRVFFGSDFITVTKSEDTSWDLLKPEIFAAIMDFYSSGQPLFLDSETAAAKDTAINEDDSETVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGTVKLRMQGACSGCPSSSVTLKSGIENMLMHYVPEVKSVEQELDAEDEVATLAGQME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NifU-like protein 4, mitochondrial Molecular scaffold for [Fe-S] cluster assembly of mitochondrial iron-sulfur proteins.probableQ9LIG6
NifU-like protein C1709.19c probableQ9UUB8
NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Molecular scaffold for [Fe-S] cluster assembly of mitochondrial iron-sulfur proteins.probableQ8SY96

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z51, chain A
Confidence level:very confident
Coverage over the Query: 125-261
View the alignment between query and template
View the model in PyMOL
Template: 2LTL, chain A
Confidence level:very confident
Coverage over the Query: 69-169
View the alignment between query and template
View the model in PyMOL