Citrus Sinensis ID: 023854


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP
cccccccccccHHHHHHHcccccccccEEEEEEEcccccEEEEEEEEcccEEEEEEEEEEECccEEEEEEEcccccEEEEEEEcccccccEEEEEEECccccccEEEEEEEccccEEEEEEECccccEEEEEEEECcccEEEEEEEEEEccccccccCEEEEEECcccEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEEEEcccccCEEEEEEEEEcccccEEEEEEccccEEEEEEEEEEcccEEEEEEEEEEccccccccEEEEEEEEcc
***GPGL*SEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNFTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial outer membrane protein porin 1 Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (By similarity). Involved in plant development at reproductive stage, is important for pollen development and may regulate hydrogen peroxide generation during disease resistance.confidentQ9SRH5
Mitochondrial outer membrane protein porin 1 Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.probableQ6K548
Mitochondrial outer membrane protein porin of 36 kDa Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.probableP42056

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EMN, chain X
Confidence level:very confident
Coverage over the Query: 2-276
View the alignment between query and template
View the model in PyMOL