Citrus Sinensis ID: 023857

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------

MATHFSSTGPMRSIFQLKSNPPKCLLFLPDSCHRRAETATCRASSVSVRQWSSAANYSRLVKLSNKPIVVRQLAHKRNGVVRCATIEEIEAEKSSIEKDVKARMERTIDMVRTNFNSVRTGRSNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQKEKELLKV

cccccccccccccHHcccccccccEECcccccccccccccccccccCEEEccccHHHHHHHHHccccEEEccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccHHHHHccccccccEEEEcccccccHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc

**************F***SNPPKCLLFLPDSCHRRAETATCRASSVSVRQWSSAANYSRLVKLSNKPIVVRQLAHKRNGVVRCATIEEIEAEKSSI***V*ARMERTIDMVRTNFNSVRTGRSNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQ***********DLSSDLQKLTDEYMKKIDSIYKQKEKELLKV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MATHFSSTGPMRSIFQLKSNPPKCLLFLPDSCHRRAETATCRASSVSVRQWSSAANYSRLVKLSNKPIVVRQLAHKRNGVVRCATxxxxxxxxxxxxxxxxxxxxxTIDMVRTNFNSVRTGRSNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYMKKIDSIYKQKEKELLKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribosome-recycling factor, chloroplastic	Responsible for the release of ribosomes from messenger RNA at the termination of chloroplastic protein biosynthesis.	probable	A3BLC3
Ribosome-recycling factor, chloroplastic	Responsible for the release of ribosomes from messenger RNA at the termination of chloroplastic protein biosynthesis.	probable	P82231
Ribosome-recycling factor, chloroplastic (Fragment)	Responsible for the release of ribosomes from messenger RNA at the termination of chloroplastic protein biosynthesis.	probable	P37706

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GFQ, chain A
Confidence level:very confident
Coverage over the Query: 94-276
View the alignment between query and template
View the model in PyMOL