Citrus Sinensis ID: 023862
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 276 | ||||||
| 118488331 | 288 | unknown [Populus trichocarpa] | 0.974 | 0.934 | 0.672 | 5e-97 | |
| 255575701 | 514 | conserved hypothetical protein [Ricinus | 0.971 | 0.521 | 0.690 | 4e-95 | |
| 449462964 | 516 | PREDICTED: uncharacterized protein At5g0 | 0.978 | 0.523 | 0.660 | 1e-93 | |
| 224077276 | 374 | predicted protein [Populus trichocarpa] | 0.786 | 0.580 | 0.764 | 2e-92 | |
| 225440882 | 495 | PREDICTED: uncharacterized protein At5g0 | 0.807 | 0.450 | 0.743 | 1e-87 | |
| 312283379 | 523 | unnamed protein product [Thellungiella h | 0.996 | 0.525 | 0.588 | 3e-87 | |
| 7406400 | 757 | putative protein [Arabidopsis thaliana] | 0.989 | 0.360 | 0.598 | 3e-87 | |
| 26453262 | 523 | unknown protein [Arabidopsis thaliana] | 0.989 | 0.521 | 0.598 | 4e-87 | |
| 21536751 | 523 | unknown [Arabidopsis thaliana] | 0.989 | 0.521 | 0.598 | 9e-87 | |
| 18414392 | 523 | Iron-sulfur assembly-like protein [Arabi | 0.989 | 0.521 | 0.598 | 1e-86 |
| >gi|118488331|gb|ABK95984.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 360 bits (923), Expect = 5e-97, Method: Compositional matrix adjust.
Identities = 189/281 (67%), Positives = 225/281 (80%), Gaps = 12/281 (4%)
Query: 1 MTSISTCFTTTPKSRFFFTPLRPSINLKPPDSFP-RIQPLPFPRISGKIPGSRVLVPVA- 58
M SIST + +P L+P + LKPPDS R Q L ++S K P + + +
Sbjct: 1 MASISTPLSYSPSP----VRLKPPVRLKPPDSLLLRTQTLH--KLSFKSPNPKTPIGFSV 54
Query: 59 KASTDVA--VGVGPGRIVESDKLPADVRNRAMDAVDACNRRVTIGDVAGKAGLKLNEAQK 116
KA+ DV +G+ PG +VE+DKLP+DVRNRAM+AVDAC RVTIGDVA +AGLKLNEAQK
Sbjct: 55 KATADVTKTMGIRPGSVVETDKLPSDVRNRAMEAVDACGGRVTIGDVASRAGLKLNEAQK 114
Query: 117 ALQALAADTDGFLEVSDEGDVLYVFPNNYRAKLAAKSFRLKVEPVIDKAKAAAEYSIRVL 176
ALQALA+DTDGFLEVSDEGDVLYVFP +YR+KLAAKS RLK EP+ +K KAAAEY IRV
Sbjct: 115 ALQALASDTDGFLEVSDEGDVLYVFPKDYRSKLAAKSLRLKFEPLFEKGKAAAEYLIRVS 174
Query: 177 FGTALIASIVIVFTAIIAILSSKSDDDDRGRRR-RSFDSGFNIFISPSDLFWYWDPYYYR 235
FGTALIASIVIV+T IIAILSS D++DRGRRR RSFD+GF ++SP+DLFWYWDPYYYR
Sbjct: 175 FGTALIASIVIVYTTIIAILSSSRDENDRGRRRSRSFDTGFAFYLSPTDLFWYWDPYYYR 234
Query: 236 RRRVQTDDDDKKMNFIKSVFSFVFGEGDPNQGIEEKRWKLV 276
RR+++TD D KMNFI+SVFSFVFG+GDPNQGIEE+RWKL+
Sbjct: 235 RRQLRTDGGD-KMNFIESVFSFVFGDGDPNQGIEEERWKLI 274
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255575701|ref|XP_002528750.1| conserved hypothetical protein [Ricinus communis] gi|223531844|gb|EEF33662.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449462964|ref|XP_004149205.1| PREDICTED: uncharacterized protein At5g03900, chloroplastic-like [Cucumis sativus] gi|449500907|ref|XP_004161226.1| PREDICTED: uncharacterized protein At5g03900, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224077276|ref|XP_002305197.1| predicted protein [Populus trichocarpa] gi|222848161|gb|EEE85708.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225440882|ref|XP_002276711.1| PREDICTED: uncharacterized protein At5g03900, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|312283379|dbj|BAJ34555.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|7406400|emb|CAB85510.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|26453262|dbj|BAC43704.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21536751|gb|AAM61083.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18414392|ref|NP_568129.1| Iron-sulfur assembly-like protein [Arabidopsis thaliana] gi|88909724|sp|Q8GW20.2|Y5390_ARATH RecName: Full=Uncharacterized protein At5g03900, chloroplastic; Flags: Precursor gi|332003286|gb|AED90669.1| Iron-sulfur assembly-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 276 | ||||||
| TAIR|locus:2150560 | 523 | AT5G03900 "AT5G03900" [Arabido | 0.989 | 0.521 | 0.535 | 1e-68 |
| TAIR|locus:2150560 AT5G03900 "AT5G03900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 697 (250.4 bits), Expect = 1.0e-68, P = 1.0e-68
Identities = 152/284 (53%), Positives = 192/284 (67%)
Query: 1 MTSISTCFTTTPK-SRFFFTPLRPS-INLKPP-D--SFPRIQPLPFPRISGKIPGSRVLV 55
M +STC +P+ ++ + +P I L+ P D SFPR+ L +S + +R +
Sbjct: 1 MACVSTCLILSPRLTQVGLSSKKPFLIRLRSPVDRYSFPRM--LTERCLSTRRKFNRHGI 58
Query: 56 PVAKA-STDVAVG-VGPGRIVESDKLPADVRNRAMDAVDACNRRVTIGDVAGKAGLKLNE 113
V KA S D G + PG +VESDKLP DVR RAMDAVD C RRVT+GDVA + GLK+ E
Sbjct: 59 AVVKAASLDKVSGAIKPGGLVESDKLPTDVRKRAMDAVDECGRRVTVGDVASRGGLKVTE 118
Query: 114 AQKALQALAADTDGFLEVSDEGDVLYVFPNNYRAKLAAKSFRLKVEPVIDKAKAAAEYSI 173
AQ ALQA+AADTDGFLEVSDEGDVLYVFP +YR KLAAKS R+++EP ++KAK A +Y
Sbjct: 119 AQTALQAIAADTDGFLEVSDEGDVLYVFPRDYRTKLAAKSLRIQIEPFLEKAKGAVDYLA 178
Query: 174 RVLFGTALIASIVIVFTAIIAILXXXXXXXXXXXXXXXXXXXX-NIFISPSDLFWYWDPX 232
RV FGTALIASIVIV+T+IIA+L N +I+P DL WYWDP
Sbjct: 179 RVSFGTALIASIVIVYTSIIALLSSKSEDDNRQRRRGRSYDSGFNFYINPVDLLWYWDPN 238
Query: 233 XXXXXXVQTDDDDKKMNFIKSVFSFVFGEGDPNQGIEEKRWKLV 276
+ +D+ K MNFI+SVFSFVFG+GDPNQGIEE+RW+++
Sbjct: 239 YYNRRRAR-EDEGKGMNFIESVFSFVFGDGDPNQGIEEERWQMI 281
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.321 0.138 0.407 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 276 249 0.00080 114 3 11 22 0.42 33
32 0.46 36
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 590 (63 KB)
Total size of DFA: 170 KB (2100 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 20.16u 0.09s 20.25t Elapsed: 00:00:00
Total cpu time: 20.16u 0.09s 20.25t Elapsed: 00:00:00
Start: Sat May 11 00:37:14 2013 End: Sat May 11 00:37:14 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 95.5 | |
| PRK13239 | 206 | alkylmercury lyase; Provisional | 95.05 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 95.0 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 94.69 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 94.04 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 93.9 | |
| PF12324 | 77 | HTH_15: Helix-turn-helix domain of alkylmercury ly | 93.63 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 93.61 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 93.46 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 93.38 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 93.3 | |
| PF06163 | 127 | DUF977: Bacterial protein of unknown function (DUF | 92.61 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 92.07 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 92.06 | |
| KOG3341 | 249 | consensus RNA polymerase II transcription factor c | 91.91 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 91.89 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 91.83 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 91.53 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 91.33 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 90.23 | |
| PF09743 | 272 | DUF2042: Uncharacterized conserved protein (DUF204 | 90.23 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 89.29 | |
| PRK15466 | 166 | carboxysome structural protein EutK; Provisional | 88.42 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 88.0 | |
| PF04539 | 78 | Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 | 87.72 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 87.57 | |
| PF08221 | 62 | HTH_9: RNA polymerase III subunit RPC82 helix-turn | 86.41 | |
| smart00088 | 88 | PINT motif in proteasome subunits, Int-6, Nip-1 an | 85.17 | |
| smart00753 | 88 | PAM PCI/PINT associated module. | 85.17 | |
| PRK10434 | 256 | srlR DNA-bindng transcriptional repressor SrlR; Pr | 84.34 | |
| PRK09802 | 269 | DNA-binding transcriptional regulator AgaR; Provis | 84.17 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 84.06 | |
| COG2512 | 258 | Predicted membrane-associated trancriptional regul | 83.89 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 83.2 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 82.56 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 82.48 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 82.4 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 82.15 | |
| PF06969 | 66 | HemN_C: HemN C-terminal domain; InterPro: IPR01072 | 82.12 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 81.51 | |
| PHA02943 | 165 | hypothetical protein; Provisional | 81.44 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 80.19 |
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
Probab=95.50 E-value=0.034 Score=41.47 Aligned_cols=46 Identities=15% Similarity=0.252 Sum_probs=41.6
Q ss_pred CchhhHHHHHHHHHcCC-ceehhhhhhhcCCCHHHHHHHHHHHHhhc
Q 023862 80 PADVRNRAMDAVDACNR-RVTIGDVAGKAGLKLNEAQKALQALAADT 125 (276)
Q Consensus 80 ~~~~~~rim~Ave~lg~-rvTvgDVAa~aGL~l~~Ae~aL~aLAsD~ 125 (276)
+..++.+|++++.+.|. .+|+.|+|.+.|++...+.+.|..|..+.
T Consensus 4 ~~~~~~~IL~~L~~~g~~~~ta~eLa~~lgl~~~~v~r~L~~L~~~G 50 (68)
T smart00550 4 QDSLEEKILEFLENSGDETSTALQLAKNLGLPKKEVNRVLYSLEKKG 50 (68)
T ss_pred chHHHHHHHHHHHHCCCCCcCHHHHHHHHCCCHHHHHHHHHHHHHCC
Confidence 34677899999999988 69999999999999999999999998873
|
Helix-turn-helix-containing domain. Also known as Zab. |
| >PRK13239 alkylmercury lyase; Provisional | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >KOG3341 consensus RNA polymerase II transcription factor complex subunit [Transcription] | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PRK15466 carboxysome structural protein EutK; Provisional | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PF04539 Sigma70_r3: Sigma-70 region 3; InterPro: IPR007624 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >PF08221 HTH_9: RNA polymerase III subunit RPC82 helix-turn-helix domain; InterPro: IPR013197 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >smart00753 PAM PCI/PINT associated module | Back alignment and domain information |
|---|
| >PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional | Back alignment and domain information |
|---|
| >PRK09802 DNA-binding transcriptional regulator AgaR; Provisional | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >COG2512 Predicted membrane-associated trancriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PF06969 HemN_C: HemN C-terminal domain; InterPro: IPR010723 Proteins containing this domain are all oxygen-independent coproporphyrinogen-III oxidases (HemN) | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >PHA02943 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 96.0 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 95.83 | |
| 3i71_A | 68 | Ethanolamine utilization protein EUTK; helix-turn- | 95.75 | |
| 3f2g_A | 220 | Alkylmercury lyase; MERB, organomercurial lyase, m | 95.73 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 94.84 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 93.97 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 93.85 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 93.6 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 92.82 | |
| 3cuq_B | 218 | Vacuolar protein-sorting-associated protein 36; ES | 92.58 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 92.4 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 92.32 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 92.13 | |
| 3cuq_A | 234 | Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu | 90.73 | |
| 1u5t_A | 233 | Appears to BE functionally related to SNF7; SNF8P; | 90.53 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 90.48 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 90.24 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 90.16 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 90.03 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 89.94 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 89.38 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 89.0 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 88.87 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 88.7 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 88.61 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 88.36 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 88.34 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 85.65 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 85.39 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 84.5 | |
| 3h5t_A | 366 | Transcriptional regulator, LACI family; DNA-depend | 84.38 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 84.27 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 84.15 | |
| 2v9v_A | 135 | Selenocysteine-specific elongation factor; transcr | 83.77 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 83.34 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 82.69 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 82.54 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 82.37 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 82.23 | |
| 2dk8_A | 81 | DNA-directed RNA polymerase III 39 kDa polypeptide | 81.48 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 81.44 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 81.43 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 81.38 | |
| 3vp5_A | 189 | Transcriptional regulator; heme, sensor protein, T | 81.34 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 81.11 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 80.42 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 80.16 |
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
Probab=96.00 E-value=0.019 Score=41.21 Aligned_cols=51 Identities=10% Similarity=0.143 Sum_probs=44.3
Q ss_pred hhHHHHHHHHHcCCceehhhhhhhcCCCHHHHHHHHHHHHhhcCCceEeecCc
Q 023862 83 VRNRAMDAVDACNRRVTIGDVAGKAGLKLNEAQKALQALAADTDGFLEVSDEG 135 (276)
Q Consensus 83 ~~~rim~Ave~lg~rvTvgDVAa~aGL~l~~Ae~aL~aLAsD~~GhLeVSesG 135 (276)
.+.+|++.+++.+..+|+.|+|.+.|++...+.+.|..|.++.- ++.++.|
T Consensus 11 ~~~~IL~~L~~~~~~~s~~eLA~~lglsr~tv~~~l~~L~~~G~--I~~~~~G 61 (67)
T 2heo_A 11 LEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDR--VSSPSPK 61 (67)
T ss_dssp HHHHHHHHHHHHCSCEEHHHHHHHHCSCHHHHHHHHHHHHHTTS--EEEEETT
T ss_pred HHHHHHHHHHHcCCCcCHHHHHHHHCcCHHHHHHHHHHHHHCCc--EecCCCc
Confidence 57899999999888899999999999999999999999987644 6656666
|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury resistance, mercuric resistance, plasmid; 1.78A {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A 3f0p_A 3f2f_A | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A | Back alignment and structure |
|---|
| >1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2v9v_A Selenocysteine-specific elongation factor; transcription, protein conformational change, transcription elongation factor SELB; 1.10A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 276 | |||
| d1u5ta2 | 68 | Vacuolar sorting protein SNF8 {Baker's yeast (Sacc | 94.87 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 92.13 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 89.53 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 89.46 | |
| d1l0oc_ | 57 | SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | 88.71 | |
| d1s6la1 | 60 | Alkylmercury lyase MerB {Escherichia coli [TaxId: | 88.62 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 88.62 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 88.23 | |
| d1q1ha_ | 88 | Transcription factor E/IIe-alpha, N-terminal domai | 88.18 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 87.72 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 85.59 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 84.95 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 84.9 | |
| d1rp3a1 | 77 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 84.5 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 83.89 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 82.6 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.03 | |
| d1t33a1 | 88 | Putative transcriptional repressor YbiH {Salmonell | 80.97 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 80.14 |
| >d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Vacuolar sorting protein domain domain: Vacuolar sorting protein SNF8 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=94.87 E-value=0.015 Score=41.90 Aligned_cols=61 Identities=13% Similarity=0.211 Sum_probs=50.4
Q ss_pred hHHHHHHHHHcCCceehhhhhhhcCCCHHHHHHHHHHHHhhcCCceEeecCccEEEEcCcch
Q 023862 84 RNRAMDAVDACNRRVTIGDVAGKAGLKLNEAQKALQALAADTDGFLEVSDEGDVLYVFPNNY 145 (276)
Q Consensus 84 ~~rim~Ave~lg~rvTvgDVAa~aGL~l~~Ae~aL~aLAsD~~GhLeVSesGDIlYvFP~nf 145 (276)
+..|+++++.. +.||+..+-.+.|-+.+-|+++|..|..+.=+=+---..||..|=||.-|
T Consensus 5 qt~vLe~a~~~-G~Vt~s~l~~~lgW~~~Ra~~aLd~lv~eGl~WvD~Q~~~e~~YWfPsl~ 65 (68)
T d1u5ta2 5 QTKILEICSIL-GYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWI 65 (68)
T ss_dssp HHHHHHTTTTT-SCCBHHHHHHHHCCCSHHHHHHHHHHHHTTSSEEECSSSSSCEEECGGGG
T ss_pred HHHHHHHHHHc-CceeHHHHHHHhCCCHHHHHHHHHHHHhcCcEEEecCCCCCceeeChHhh
Confidence 46788899888 58999999999999999999999999986544444333589999999765
|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|