Citrus Sinensis ID: 023865

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------

MAVVVGNLALLLDVASPRTLITDRKSRPLALDVLLNLPKRDLHLNYSALANKSLDSEGESWNHRVVTRGKVNSKVNAVDFDAGSSDEENGNGNGEKEEYDWEKEMRRRVKEIEEMRELEKKAEELQSKAEEDDSESEAKEETEEEKRMRVRRELEKVAKEQAERRATAQLMFELGQKAYGKGMYGRAIEFLEGALTIIPRPTFFGGEIQIWLAMAYEANNRHADCIALYKQLESNHPSKNIRRQAADLRYILQAPKLKISQEEMVTIPLIGSSYDR

cccccccHHHHcccccccEECccccccccHHHHHHcccccccccHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccc

**VVVGNLALLLDVASPRTLITDRKSRPLALDVLLNLPKRDLHLNYSALAN*SLDSEGESWNHRVVT*****************************************************************************************************QLMFELGQKAYGKGMYGRAIEFLEGALTIIPRPTFFGGEIQIWLAMAYEANNRHADCIALYKQLESNHPSKNIRRQAADLRYILQAPKLKISQEEMVTIPLI******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAVVVGNLALLLDVASPRTLITDRKSRPLALDVLLNLPKRDLHLNYSALANKSLDSEGESWNHRVVTRGKVNSKVNAVDFDAGSSDEENGNGNGEKEEYDWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQAERRATAQLMFELGQKAYGKGMYGRAIEFLEGALTIIPRPTFFGGEIQIWLAMAYEANNRHADCIALYKQLESNHPSKNIRRQAADLRYILQAPKLKISQEEMVTIPLIGSSYDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GW4, chain A
Confidence level:probable
Coverage over the Query: 166-254
View the alignment between query and template
View the model in PyMOL

Template: 2XRH, chain A
Confidence level:probable
Coverage over the Query: 75-156
View the alignment between query and template
View the model in PyMOL