Citrus Sinensis ID: 023875


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAGGCDEEISLFLYRGRVDKEIIMQLQGKETGLRDHGELIKVRVVPYRELWRTTPDAKVLTAIALYEMASKEELLPSRT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHcccHHHHHHHHHHccccccccccEEEEEEEEEEEccccEEEEEEEEEEEECccccccccccccccEEEEccCCcccccccHHHHHHHHHHHHHccccccccccHHHHccccccccccccccccccccEEEEEEEEcccHHHHHHHHccccccccccccEEEEEEcHHHHHHHccHHHHHHHHHHHHHHHccccccccc
*****YTLPKRLTVSPSPPLLHFNY**********************************VHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAGGCDEEISLFLYRGRVDKEIIMQLQGKETGLRDHGELIKVRVVPYRELWRTTPDAKVLTAIALYEMAS*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLFYTLPKRLTVSPSPPLLHFNYRSSRTRLVCSKMPTESSPSPLTHSITIPSQLSQPVHVVAAPGLSESDFRCAVESTLFKQWLKNLQSETGILANGDMLLKQVLIQGVDMFGKRIGFLKFKADIFCKETGQKVRVPTGRVILELPAGMLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAGGCDEEISLFLYRGRVDKEIIMQLQGKETGLRDHGELIKVRVVPYRELWRTTPDAKVLTAIALYEMASKEELLPSRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 14, chloroplastic Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can use ADP-glucose, ADP-mannose and ADP-ribose as substrates. Regulates the intracellular ADP-glucose levels linked to starch biosynthesis.probableQ9SZ63

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.21ADP-sugar diphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G0S, chain A
Confidence level:very confident
Coverage over the Query: 69-265
View the alignment between query and template
View the model in PyMOL
Template: 3DUP, chain A
Confidence level:confident
Coverage over the Query: 78-274
View the alignment between query and template
View the model in PyMOL