Citrus Sinensis ID: 023883

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MAENNKPGEIKDFQIMIANKDDSTKKLAPKRSSNKDRHKKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASMLAAAGASVSEQGNSVSAGLHTKIEGLGPGVGSINRANWTMMSANFGRSQIPSGVWPTINGTGSGFIQNSGQLTSNFGSENLSLSANPKFGFHGIEFPNMNMGLMSFSSMLSGASHQIPGLELGLSQDAHVGVMNSQAISQFYQQMGHHRSASGSLNQQHQHQQQISDKDDSQGSGSRQ
cccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHcccccccccccccccccc
***********************************************IRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASML***************************************************GVWP******SGFIQN*****************NPKFGFHGIEFPNMNMGLMSFS*********IPGLELGLS*DAHVGVM*********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAENNKPGEIKDFQIMIANKDDSTKKLAPKRSSNKDRHKKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASMLAAAGASVSEQGNSVSAGLHTKIEGLGPGVGSINRANWTMMSANFGRSQIPSGVWPTINGTGSGFIQNSGQLTSNFGSENLSLSANPKFGFHGIEFPNMNMGLMSFSSMLSGASHQIPGLELGLSQDAHVGVMNSQAISQFYQQMGHHRSASGSLNQQHQHQQQISDKDDSQGSGSRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor TCP20 Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes.probableQ9LSD5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted