Citrus Sinensis ID: 023896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MAEATKKYAVVTGSNKGIGFETVRQLASKGITVVLTARDEKRGLEAVEKLKASGVDPELLLFHQLDISDLASVSSLADFIKTQFGKLDILTKGDAEVDWSKVCYQTYELAVECLKTNYYGTKQTCEALIPLLELSDSPRLVNLSSYVSALKDLPEKARAVLGDVENLTEERIEMVVKDYFKDYEEGEIANRGWCPHSSAYKVSKAVINAYTRILAKRYPKFCVNCVCPGFVKTDINFHAGILSVEEGAESPVKLALLPDGGPTGRFFLRKEEAPF
cccccccEEEECccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccccEEEEECccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHccccccccccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEccCCccc
****TKKYAVVTGSNKGIGFETVRQLASKGITVVLTARDEKRGLEAVEKLKASGVDPELLLFHQLDISDLASVSSLADFIKTQFGKLDILTKGDAEVDWSKVCYQTYELAVECLKTNYYGTKQTCEALIPLLELSDSPRLVNLSSYVSALKDLPEKARAVLGDVENLTEERIEMVVKDYFKDYEEGEIANRGWCPHSSAYKVSKAVINAYTRILAKRYPKFCVNCVCPGFVKTDINFHAGILSVEEGAESPVKLALLPDGGPTGRFFLRKEEAPF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEATKKYAVVTGSNKGIGFETVRQLASKGITVVLTARDEKRGLEAVEKLKASGVDPELLLFHQLDISDLASVSSLADFIKTQFGKLDILTKGDAEVDWSKVCYQTYELAVECLKTNYYGTKQTCEALIPLLELSDSPRLVNLSSYVSALKDLPEKARAVLGDVENLTEERIEMVVKDYFKDYEEGEIANRGWCPHSSAYKVSKAVINAYTRILAKRYPKFCVNCVCPGFVKTDINFHAGILSVEEGAESPVKLALLPDGGPTGRFFLRKEEAPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
(+)-neomenthol dehydrogenase Involved in basal resistance against pathogens.probableQ9M2E2
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.probableQ5RCU5
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.probableP16152

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O26, chain A
Confidence level:very confident
Coverage over the Query: 6-269
View the alignment between query and template
View the model in PyMOL