Citrus Sinensis ID: 023913


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccccccEEEEEccccccccccccccccccHHHHHHccccccEEEEECcccCEECccccccccEEEEEEEccccccccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHc
******************************************************SHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Urease accessory protein UreG Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableA9GP90
Urease accessory protein UreG Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableQ02FC5
Urease accessory protein UreG 1 Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.probableB1ZHN6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HF9, chain A
Confidence level:very confident
Coverage over the Query: 80-271
View the alignment between query and template
View the model in PyMOL
Template: 2QM8, chain A
Confidence level:confident
Coverage over the Query: 69-271
View the alignment between query and template
View the model in PyMOL
Template: 1UDX, chain A
Confidence level:confident
Coverage over the Query: 32-192,216-271
View the alignment between query and template
View the model in PyMOL
Template: 1PQ4, chain A
Confidence level:probable
Coverage over the Query: 49-54
View the alignment between query and template
View the model in PyMOL