Citrus Sinensis ID: 023913


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccccccEEEEEccccccccccccccccccHHHHHHccccccEEEEEEcccEEEEccccccccEEEEEEEccccccccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHc
cccccccccccccccccccccccccccccccccccccEcccccEEEcccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccccHHHEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHccEEEEEEEccccccccccccccccHccEEEEEcccccHHccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcc
mashdhhthdhahhhhhdndhdhtheknhgdstatswvgsdgrvyhshdglaphshepiyspgyfsrrappilsrnfneraftvgiggpvgtGKTALMLALCKFLRDKYslaavtndiftkedgeflmrngalpeeriravetggcphaairedisinlgpleelsnlFKADLLLcesggdnlaaNFSRELADYIIYIIDVsggdkiprkggpgitqadlLVINKTDLASAIGADLAVMERDalrmrdggpfifAQVGWVIGIIFTLSITHYIVS
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTndiftkedgefLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
MAShdhhthdhahhhhhdndhdhthEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
**********************************************************IYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIV*
******************************************************SHEPIYSPGYFS***P***SRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
*********************************ATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
************************************WVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHDHHTHDHAHHHHHDNDHDHTHEKNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
Q96WV0286 Uncharacterized urease ac yes no 0.763 0.734 0.672 4e-77
A9GP90302 Urease accessory protein yes no 0.730 0.665 0.702 3e-75
Q11VN1244 Urease accessory protein yes no 0.738 0.831 0.666 2e-72
A7HHN3236 Urease accessory protein yes no 0.756 0.881 0.682 1e-71
B1M3X4205 Urease accessory protein yes no 0.64 0.858 0.661 8e-63
B8IJ81204 Urease accessory protein yes no 0.64 0.862 0.672 1e-62
B0UBI3204 Urease accessory protein yes no 0.64 0.862 0.666 3e-62
A4VQW0204 Urease accessory protein yes no 0.650 0.877 0.644 4e-62
A4XQ16204 Urease accessory protein yes no 0.650 0.877 0.633 4e-62
Q8DMQ4200 Urease accessory protein yes no 0.672 0.925 0.612 6e-62
>sp|Q96WV0|UREG_SCHPO Uncharacterized urease accessory protein ureG-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB16A4.05c PE=3 SV=1 Back     alignment and function desciption
 Score =  288 bits (736), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 176/211 (83%), Gaps = 1/211 (0%)

Query: 54  HSHEPIYSPG-YFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDKYSLA 112
           HSH+ + +PG Y  R  P    R+F+ RAFT+G+GGPVG+GKTAL+L LC+ L +KYS+ 
Sbjct: 58  HSHDAMETPGSYLKRELPQFNHRDFSRRAFTIGVGGPVGSGKTALLLQLCRLLGEKYSIG 117

Query: 113 AVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKAD 172
            VTNDIFT+ED EFL+RN ALPEERIRA+ETGGCPHAAIRED+S NL  LEEL + F  +
Sbjct: 118 VVTNDIFTREDQEFLIRNKALPEERIRAIETGGCPHAAIREDVSGNLVALEELQSEFNTE 177

Query: 173 LLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAI 232
           LLL ESGGDNLAAN+SR+LAD+IIY+IDVSGGDKIPRKGGPGIT++DLL+INKTDLA  +
Sbjct: 178 LLLVESGGDNLAANYSRDLADFIIYVIDVSGGDKIPRKGGPGITESDLLIINKTDLAKLV 237

Query: 233 GADLAVMERDALRMRDGGPFIFAQVGWVIGI 263
           GADL+VM+RDA ++R+ GP +FAQV   +G+
Sbjct: 238 GADLSVMDRDAKKIRENGPIVFAQVKNQVGM 268




Probably facilitates nickel incorporation.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|A9GP90|UREG_SORC5 Urease accessory protein UreG OS=Sorangium cellulosum (strain So ce56) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|Q11VN1|UREG_CYTH3 Urease accessory protein UreG OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|A7HHN3|UREG_ANADF Urease accessory protein UreG OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|B1M3X4|UREG1_METRJ Urease accessory protein UreG 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ureG1 PE=3 SV=1 Back     alignment and function description
>sp|B8IJ81|UREG_METNO Urease accessory protein UreG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|B0UBI3|UREG_METS4 Urease accessory protein UreG OS=Methylobacterium sp. (strain 4-46) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|A4VQW0|UREG_PSEU5 Urease accessory protein UreG OS=Pseudomonas stutzeri (strain A1501) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|A4XQ16|UREG_PSEMY Urease accessory protein UreG OS=Pseudomonas mendocina (strain ymp) GN=ureG PE=3 SV=1 Back     alignment and function description
>sp|Q8DMQ4|UREG_THEEB Urease accessory protein UreG OS=Thermosynechococcus elongatus (strain BP-1) GN=ureG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
222143562279 urease accessory protein ureG [Morus alb 0.850 0.838 0.905 1e-121
297740673 521 unnamed protein product [Vitis vinifera] 0.945 0.499 0.825 1e-121
297826907278 predicted protein [Arabidopsis lyrata su 0.861 0.852 0.890 1e-121
255557339275 Urease accessory protein ureG, putative 0.832 0.832 0.908 1e-120
15226754275 urease accessory protein [Arabidopsis th 0.861 0.861 0.886 1e-120
79324312276 urease accessory protein [Arabidopsis th 0.861 0.858 0.886 1e-120
449500609287 PREDICTED: uncharacterized urease access 0.854 0.818 0.886 1e-120
449459358277 PREDICTED: uncharacterized urease access 0.854 0.848 0.886 1e-120
225463462369 PREDICTED: uncharacterized urease access 0.909 0.677 0.856 1e-120
147811197369 hypothetical protein VITISV_030019 [Viti 0.909 0.677 0.856 1e-120
>gi|222143562|dbj|BAH19310.1| urease accessory protein ureG [Morus alba] Back     alignment and taxonomy information
 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/234 (90%), Positives = 224/234 (95%)

Query: 30  GDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGP 89
           GDS   +WVG DGRVYHSHDGLAPHSHEPIYSPG FS+RAPP+L+R+FNERAFT+GIGGP
Sbjct: 26  GDSRTGAWVGPDGRVYHSHDGLAPHSHEPIYSPGSFSKRAPPLLTRDFNERAFTIGIGGP 85

Query: 90  VGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHA 149
           VGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFL++NGALPEERIRAVETGGCPHA
Sbjct: 86  VGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLVKNGALPEERIRAVETGGCPHA 145

Query: 150 AIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPR 209
           AIREDISINLGPLEELSNLFKAD+LLCESGGDNLAANFSRELADYIIYIIDVS GDKIPR
Sbjct: 146 AIREDISINLGPLEELSNLFKADILLCESGGDNLAANFSRELADYIIYIIDVSAGDKIPR 205

Query: 210 KGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGI 263
           KGGPGITQADLLVINKTDLA A+GADLAVMERDALRMRDGGPF+FAQV   +GI
Sbjct: 206 KGGPGITQADLLVINKTDLAPAVGADLAVMERDALRMRDGGPFVFAQVKHGVGI 259




Source: Morus alba

Species: Morus alba

Genus: Morus

Family: Moraceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297740673|emb|CBI30855.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297826907|ref|XP_002881336.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297327175|gb|EFH57595.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255557339|ref|XP_002519700.1| Urease accessory protein ureG, putative [Ricinus communis] gi|223541117|gb|EEF42673.1| Urease accessory protein ureG, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15226754|ref|NP_180994.1| urease accessory protein [Arabidopsis thaliana] gi|3128220|gb|AAC26700.1| putative urease accessory protein [Arabidopsis thaliana] gi|20197163|gb|AAM14950.1| putative urease accessory protein [Arabidopsis thaliana] gi|21553947|gb|AAM63028.1| putative urease accessory protein [Arabidopsis thaliana] gi|26453270|dbj|BAC43708.1| putative urease accessory protein [Arabidopsis thaliana] gi|28950833|gb|AAO63340.1| At2g34470 [Arabidopsis thaliana] gi|330253884|gb|AEC08978.1| urease accessory protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79324312|ref|NP_001031481.1| urease accessory protein [Arabidopsis thaliana] gi|330253885|gb|AEC08979.1| urease accessory protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449500609|ref|XP_004161145.1| PREDICTED: uncharacterized urease accessory protein ureG-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459358|ref|XP_004147413.1| PREDICTED: uncharacterized urease accessory protein ureG-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225463462|ref|XP_002276305.1| PREDICTED: uncharacterized urease accessory protein ureG-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147811197|emb|CAN70160.1| hypothetical protein VITISV_030019 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
TAIR|locus:2040894276 UREG "AT2G34470" [Arabidopsis 0.861 0.858 0.886 1.4e-112
UNIPROTKB|G4NCH0277 MGG_01086 "Uncharacterized pro 0.792 0.787 0.699 2.5e-83
POMBASE|SPCPB16A4.05c286 SPCPB16A4.05c "urease accessor 0.763 0.734 0.672 4.1e-77
ASPGD|ASPL0000062920266 ureD [Emericella nidulans (tax 0.770 0.796 0.688 5.5e-77
UNIPROTKB|Q48DC7205 ureG "Urease accessory protein 0.647 0.868 0.631 2.5e-56
UNIPROTKB|P0A664224 ureG "Urease accessory protein 0.705 0.866 0.545 1.1e-53
UNIPROTKB|P18319205 ureG "Urease accessory protein 0.661 0.887 0.606 1e-52
TIGR_CMR|SPO_1717215 SPO_1717 "urease accessory pro 0.632 0.809 0.6 3.5e-52
TIGR_CMR|CJE_0726247 CJE_0726 "hydrogenase accessor 0.658 0.732 0.264 1.1e-06
TIGR_CMR|GSU_0305254 GSU_0305 "hydrogenase accessor 0.705 0.763 0.285 6.7e-06
TAIR|locus:2040894 UREG "AT2G34470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1111 (396.2 bits), Expect = 1.4e-112, P = 1.4e-112
 Identities = 210/237 (88%), Positives = 224/237 (94%)

Query:    27 KNHGDSTATSWVGSDGRVYHSHDGLAPHSHEPIYSPGYFSRRAPPILSRNFNERAFTVGI 86
             K+ G     SWVG DG+VYHSHDGLAPHSHEPIYSPGYFSRRAPP+  RNF+ERAFTVGI
Sbjct:    20 KSDGGEGKASWVGKDGKVYHSHDGLAPHSHEPIYSPGYFSRRAPPLHDRNFSERAFTVGI 79

Query:    87 GGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGC 146
             GGPVGTGKTALMLALC+FLRDKYSLAAVTNDIFTKEDGEFL++NGALPEERIRAVETGGC
Sbjct:    80 GGPVGTGKTALMLALCRFLRDKYSLAAVTNDIFTKEDGEFLVKNGALPEERIRAVETGGC 139

Query:   147 PHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDK 206
             PHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVS GDK
Sbjct:   140 PHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSAGDK 199

Query:   207 IPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGI 263
             IPRKGGPGITQADLLVINKTDLA+A+GADL+VMERD+LRMRDGGPF+FAQV   +G+
Sbjct:   200 IPRKGGPGITQADLLVINKTDLAAAVGADLSVMERDSLRMRDGGPFVFAQVKHGLGV 256




GO:0000166 "nucleotide binding" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0016151 "nickel cation binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=ISS
GO:0006807 "nitrogen compound metabolic process" evidence=IMP
GO:0048554 "positive regulation of metalloenzyme activity" evidence=IMP
GO:0016020 "membrane" evidence=IDA
UNIPROTKB|G4NCH0 MGG_01086 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPCPB16A4.05c SPCPB16A4.05c "urease accessory protein UREG (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062920 ureD [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q48DC7 ureG "Urease accessory protein UreG" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|P0A664 ureG "Urease accessory protein UreG" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|P18319 ureG "Urease accessory protein UreG" [Enterobacter aerogenes (taxid:548)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1717 SPO_1717 "urease accessory protein UreG" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0726 CJE_0726 "hydrogenase accessory protein HypB" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0305 GSU_0305 "hydrogenase accessory protein HypB" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q02FC5UREG_PSEABNo assigned EC number0.63880.65090.8774yesno
B1ZHN6UREG1_METPBNo assigned EC number0.64970.640.8627yesno
B8EPU6UREG_METSBNo assigned EC number0.61200.66180.8834yesno
Q6FD79UREG_ACIADNo assigned EC number0.62290.65810.8872yesno
Q0I662UREG_SYNS3No assigned EC number0.64400.640.88yesno
B0V9P2UREG_ACIBYNo assigned EC number0.62290.65810.8872yesno
Q0AC95UREG_ALHEHNo assigned EC number0.64040.64360.8388yesno
A3M3F5UREG_ACIBTNo assigned EC number0.62290.65810.8872yesno
Q4QN12UREG_HAEI8No assigned EC number0.5550.68720.84yesno
Q8DMQ4UREG_THEEBNo assigned EC number0.61290.67270.925yesno
A6SZ10UREG_JANMANo assigned EC number0.63270.640.8341yesno
Q2SDP8UREG_HAHCHNo assigned EC number0.59890.65810.8872yesno
A9W6X0UREG1_METEPNo assigned EC number0.64970.640.8627yesno
Q7V3V8UREG_PROMMNo assigned EC number0.63270.640.8712yesno
Q0BHN8UREG_BURCMNo assigned EC number0.54540.720.9209yesno
B1JX26UREG_BURCCNo assigned EC number0.57650.70900.9069yesno
A4VQW0UREG_PSEU5No assigned EC number0.64440.65090.8774yesno
Q96WV0UREG_SCHPONo assigned EC number0.67290.76360.7342yesno
Q3AGD6UREG_SYNSCNo assigned EC number0.63840.640.8756yesno
P44396UREG_HAEINNo assigned EC number0.560.68720.84yesno
Q11VN1UREG_CYTH3No assigned EC number0.66660.73810.8319yesno
B8IJ81UREG_METNONo assigned EC number0.67230.640.8627yesno
B2HVS4UREG_ACIBCNo assigned EC number0.62290.65810.8872yesno
Q9HUS0UREG_PSEAENo assigned EC number0.63880.65090.8774yesno
B0VSB5UREG_ACIBSNo assigned EC number0.62290.65810.8872yesno
B3H2K9UREG_ACTP7No assigned EC number0.56770.65810.8578yesno
A1KBB1UREG_AZOSBNo assigned EC number0.63530.65450.8695yesno
B0UBI3UREG_METS4No assigned EC number0.66660.640.8627yesno
A7HHN3UREG_ANADFNo assigned EC number0.68260.75630.8813yesno
A2CDZ5UREG_PROM3No assigned EC number0.63840.640.8669yesno
A3N2R0UREG_ACTP2No assigned EC number0.57290.65810.8578yesno
A0K573UREG_BURCHNo assigned EC number0.57650.70900.9069yesno
A6UC29UREG_SINMWNo assigned EC number0.64400.640.8669yesno
Q3J773UREG_NITOCNo assigned EC number0.60430.65810.8916yesno
Q1BYH5UREG_BURCANo assigned EC number0.57650.70900.9069yesno
A4XQ16UREG_PSEMYNo assigned EC number0.63330.65090.8774yesno
B1M3X4UREG1_METRJNo assigned EC number0.66100.640.8585yesno
B7I8T8UREG_ACIB5No assigned EC number0.62290.65810.8872yesno
B7GXU0UREG_ACIB3No assigned EC number0.62290.65810.8872yesno
A9GP90UREG_SORC5No assigned EC number0.70290.73090.6655yesno
B1YUF6UREG_BURA4No assigned EC number0.54540.720.9209yesno
Q39IW6UREG_BURS3No assigned EC number0.57650.70900.9069yesno
O54424UREG_ACTPLNo assigned EC number0.56770.65810.8578yesno
Q1H0F5UREG_METFKNo assigned EC number0.65710.63270.8571yesno
C1DMZ7UREG_AZOVDNo assigned EC number0.650.65090.8774yesno
A6VD02UREG_PSEA7No assigned EC number0.62770.65090.8774yesno
B7V1V6UREG_PSEA8No assigned EC number0.63880.65090.8774yesno
A4JC39UREG_BURVGNo assigned EC number0.55020.720.9209yesno
B0BRT8UREG_ACTPJNo assigned EC number0.57290.65810.8578yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
Al_scaffold_0004_1925
annotation not avaliable (278 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
scaffold_201576.1
annotation not avaliable (837 aa)
   0.992
fgenesh2_kg.1__2374__AT1G21840.1
annotation not avaliable (240 aa)
    0.971
fgenesh2_kg.4__1529__AT2G35035.1
annotation not avaliable (293 aa)
    0.964
scaffold_601372.1
annotation not avaliable (1381 aa)
       0.666
fgenesh2_kg.4__1804__AT2G37500.1
annotation not avaliable (468 aa)
      0.605
fgenesh2_kg.1__3154__AT1G29900.1
annotation not avaliable (1183 aa)
       0.583
scaffold_701843.1
annotation not avaliable (495 aa)
       0.561
fgenesh2_kg.8__2775__AT5G66470.1
annotation not avaliable (427 aa)
      0.561
fgenesh2_kg.5__1206__AT3G48560.1
AT3G48560 (664 aa)
       0.505
fgenesh2_kg.5__2197__AT3G57560.1
annotation not avaliable (346 aa)
       0.497

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
TIGR00101199 TIGR00101, ureG, urease accessory protein UreG 1e-87
COG0378202 COG0378, HypB, Ni2+-binding GTPase involved in reg 1e-70
pfam02492178 pfam02492, cobW, CobW/HypB/UreG, nucleotide-bindin 4e-44
TIGR00073208 TIGR00073, hypB, hydrogenase accessory protein Hyp 1e-14
PRK10019279 PRK10019, PRK10019, nickel/cobalt efflux protein R 2e-05
PRK09545311 PRK09545, znuA, high-affinity zinc transporter per 3e-05
PRK09545311 PRK09545, znuA, high-affinity zinc transporter per 1e-04
PRK10019279 PRK10019, PRK10019, nickel/cobalt efflux protein R 4e-04
PRK13263206 PRK13263, ureE, urease accessory protein UreE; Pro 5e-04
PRK10019279 PRK10019, PRK10019, nickel/cobalt efflux protein R 6e-04
pfam10986161 pfam10986, DUF2796, Protein of unknown function (D 6e-04
PRK10019279 PRK10019, PRK10019, nickel/cobalt efflux protein R 0.001
PRK13263206 PRK13263, ureE, urease accessory protein UreE; Pro 0.002
cd01019286 cd01019, ZnuA, Zinc binding protein ZnuA 0.002
PRK09545311 PRK09545, znuA, high-affinity zinc transporter per 0.003
cd01019286 cd01019, ZnuA, Zinc binding protein ZnuA 0.003
COG1072283 COG1072, CoaA, Panthothenate kinase [Coenzyme meta 0.003
pfam03308267 pfam03308, ArgK, ArgK protein 0.003
>gnl|CDD|129208 TIGR00101, ureG, urease accessory protein UreG Back     alignment and domain information
 Score =  259 bits (662), Expect = 1e-87
 Identities = 110/175 (62%), Positives = 135/175 (77%), Gaps = 1/175 (0%)

Query: 84  VGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVET 143
           +G+ GPVG+GKTAL+ AL + LR KY LA +TNDI+T+ED EFL++N ALP ERI  VET
Sbjct: 4   IGVAGPVGSGKTALIEALTRALRQKYQLAVITNDIYTQEDAEFLVKNSALPPERILGVET 63

Query: 144 GGCPHAAIREDISINLGPLEELSNLF-KADLLLCESGGDNLAANFSRELADYIIYIIDVS 202
           GGCPH AIRED S+NL  + E+   F   +++  ESGGDNL+A FS ELAD  I++IDV+
Sbjct: 64  GGCPHTAIREDASMNLEAVAEMEARFPPLEMVFIESGGDNLSATFSPELADLTIFVIDVA 123

Query: 203 GGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQV 257
            GDKIPRKGGPGIT++DLLVINK DLA  +GADL VMERDA +MR   PFIF  +
Sbjct: 124 AGDKIPRKGGPGITRSDLLVINKIDLAPMVGADLGVMERDAKKMRGEKPFIFTNL 178


This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel [Central intermediary metabolism, Nitrogen metabolism]. Length = 199

>gnl|CDD|223455 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>gnl|CDD|217066 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|232811 TIGR00073, hypB, hydrogenase accessory protein HypB Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information
>gnl|CDD|236558 PRK09545, znuA, high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>gnl|CDD|236558 PRK09545, znuA, high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information
>gnl|CDD|237323 PRK13263, ureE, urease accessory protein UreE; Provisional Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information
>gnl|CDD|220924 pfam10986, DUF2796, Protein of unknown function (DUF2796) Back     alignment and domain information
>gnl|CDD|236641 PRK10019, PRK10019, nickel/cobalt efflux protein RcnA; Provisional Back     alignment and domain information
>gnl|CDD|237323 PRK13263, ureE, urease accessory protein UreE; Provisional Back     alignment and domain information
>gnl|CDD|238501 cd01019, ZnuA, Zinc binding protein ZnuA Back     alignment and domain information
>gnl|CDD|236558 PRK09545, znuA, high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>gnl|CDD|238501 cd01019, ZnuA, Zinc binding protein ZnuA Back     alignment and domain information
>gnl|CDD|223998 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|112137 pfam03308, ArgK, ArgK protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.96
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.95
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 99.95
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.95
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.95
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.94
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.93
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.93
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.93
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.93
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.93
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.92
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.92
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.92
COG1127263 Ttg2A ABC-type transport system involved in resist 99.92
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.92
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.91
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.91
PRK13537306 nodulation ABC transporter NodI; Provisional 99.91
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.91
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.9
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.9
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.9
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.9
COG0523 323 Putative GTPases (G3E family) [General function pr 99.9
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.9
COG0410237 LivF ABC-type branched-chain amino acid transport 99.9
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.9
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.9
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.9
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.9
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.9
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.9
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.9
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.89
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.89
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.89
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.89
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.89
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.89
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.89
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.89
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.89
PRK10908222 cell division protein FtsE; Provisional 99.89
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.89
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.89
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.89
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.89
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.89
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
COG4152300 ABC-type uncharacterized transport system, ATPase 99.89
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.89
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.89
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.89
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.88
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.88
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.88
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.88
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.88
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.88
COG0411250 LivG ABC-type branched-chain amino acid transport 99.88
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.88
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.88
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.88
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.88
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.88
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.88
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.88
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.88
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.88
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.88
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.88
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.88
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.88
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.88
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.88
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.88
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.87
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.87
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.87
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.87
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.87
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.87
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.87
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.87
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.87
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.87
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.87
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.87
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.87
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.87
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.87
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.87
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.87
COG4559259 ABC-type hemin transport system, ATPase component 99.87
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.87
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.87
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.87
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.87
COG4988559 CydD ABC-type transport system involved in cytochr 99.87
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.87
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.87
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.87
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.87
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.87
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.87
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.87
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.87
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.87
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.87
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.87
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.87
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.86
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.86
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 99.86
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.86
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.86
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.86
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.86
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.86
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.86
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.86
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.86
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.86
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.86
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.86
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.86
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.86
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.86
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.86
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.86
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.86
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.86
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.86
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.86
COG4987573 CydC ABC-type transport system involved in cytochr 99.86
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.86
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.86
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.86
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.86
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.86
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.85
cd03234226 ABCG_White The White subfamily represents ABC tran 99.85
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.85
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.85
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.85
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.85
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.85
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.85
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.85
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.85
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.85
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.85
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.85
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.85
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK10938 490 putative molybdenum transport ATP-binding protein 99.85
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.85
COG4619223 ABC-type uncharacterized transport system, ATPase 99.85
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.85
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.85
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.85
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.85
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.85
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.85
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK09984262 phosphonate/organophosphate ester transporter subu 99.85
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.85
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.85
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.85
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.85
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.85
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.85
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.85
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.85
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.85
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.85
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.85
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.85
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.85
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.84
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.84
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.84
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.84
COG4181228 Predicted ABC-type transport system involved in ly 99.84
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.84
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.84
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.84
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.84
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.84
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.84
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.84
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.84
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.84
cd03246173 ABCC_Protease_Secretion This family represents the 99.84
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.84
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.84
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.84
PRK11537 318 putative GTP-binding protein YjiA; Provisional 99.84
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.84
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.84
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.84
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.84
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.84
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.83
PLN03130 1622 ABC transporter C family member; Provisional 99.83
TIGR02475 341 CobW cobalamin biosynthesis protein CobW. A broade 99.83
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.83
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.83
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.83
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.83
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.83
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.83
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.83
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.83
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.83
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.83
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.83
KOG2743 391 consensus Cobalamin synthesis protein [Coenzyme tr 99.83
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.83
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.83
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.83
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.83
PLN032321495 ABC transporter C family member; Provisional 99.83
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.82
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.82
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.82
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.82
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.82
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.82
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.82
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.82
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.82
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.82
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.82
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.82
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.82
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.82
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.82
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.82
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.82
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.82
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.82
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.82
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.82
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.82
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.82
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.82
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.81
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.81
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.81
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.81
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.81
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.81
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.81
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.81
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.81
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.81
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.81
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.81
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.81
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10938490 putative molybdenum transport ATP-binding protein 99.81
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.81
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.81
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.8
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.8
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.8
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.8
PTZ002431560 ABC transporter; Provisional 99.8
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK09435332 membrane ATPase/protein kinase; Provisional 99.79
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.79
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.79
COG1123539 ATPase components of various ABC-type transport sy 99.79
COG1123 539 ATPase components of various ABC-type transport sy 99.78
PLN03211 659 ABC transporter G-25; Provisional 99.78
COG4586325 ABC-type uncharacterized transport system, ATPase 99.78
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.78
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.78
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.78
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.78
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.78
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.77
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.77
PRK13409 590 putative ATPase RIL; Provisional 99.77
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.77
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.77
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.77
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.77
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.77
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.77
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.76
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.76
COG4133209 CcmA ABC-type transport system involved in cytochr 99.76
COG4172534 ABC-type uncharacterized transport system, duplica 99.76
PRK11147635 ABC transporter ATPase component; Reviewed 99.76
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.76
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.76
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.76
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.76
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.75
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.75
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.75
PLN03073718 ABC transporter F family; Provisional 99.75
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.75
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.75
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.75
PRK13409590 putative ATPase RIL; Provisional 99.74
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.73
COG0488 530 Uup ATPase components of ABC transporters with dup 99.73
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.73
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.73
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.72
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.72
KOG00541381 consensus Multidrug resistance-associated protein/ 99.72
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 99.71
PRK11147 635 ABC transporter ATPase component; Reviewed 99.71
COG4136213 ABC-type uncharacterized transport system, ATPase 99.69
PLN03232 1495 ABC transporter C family member; Provisional 99.69
PLN03140 1470 ABC transporter G family member; Provisional 99.68
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.68
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.68
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.67
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.67
COG4172 534 ABC-type uncharacterized transport system, duplica 99.66
PLN03130 1622 ABC transporter C family member; Provisional 99.66
PLN03073 718 ABC transporter F family; Provisional 99.66
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.65
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.64
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.64
cd03112158 CobW_like The function of this protein family is u 99.64
PLN03140 1470 ABC transporter G family member; Provisional 99.64
PTZ00243 1560 ABC transporter; Provisional 99.63
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.61
COG0488530 Uup ATPase components of ABC transporters with dup 99.61
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.59
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.56
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.54
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.5
PRK15494 339 era GTPase Era; Provisional 99.49
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.48
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.46
COG1159 298 Era GTPase [General function prediction only] 99.46
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.46
COG1160444 Predicted GTPases [General function prediction onl 99.45
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.44
COG4178604 ABC-type uncharacterized transport system, permeas 99.43
KOG0062 582 consensus ATPase component of ABC transporters wit 99.43
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.43
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.41
PRK00089 292 era GTPase Era; Reviewed 99.4
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.39
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.39
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.39
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.38
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.38
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.38
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.34
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.31
cd00881189 GTP_translation_factor GTP translation factor fami 99.31
PRK10416318 signal recognition particle-docking protein FtsY; 99.3
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.3
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.28
cd03114148 ArgK-like The function of this protein family is u 99.27
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.26
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.25
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.23
COG0486454 ThdF Predicted GTPase [General function prediction 99.22
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.22
PRK13768253 GTPase; Provisional 99.22
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.22
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.2
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.2
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.19
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.18
PRK12298390 obgE GTPase CgtA; Reviewed 99.18
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.18
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.16
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.16
PRK00093435 GTP-binding protein Der; Reviewed 99.16
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.16
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.15
PRK12299335 obgE GTPase CgtA; Reviewed 99.14
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.13
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.13
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.13
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.12
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.11
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.11
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.1
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.09
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.09
PRK14974336 cell division protein FtsY; Provisional 99.09
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.08
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.08
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.07
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.07
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.07
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.06
PRK12296 500 obgE GTPase CgtA; Reviewed 99.06
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.06
PRK03003472 GTP-binding protein Der; Reviewed 99.06
COG1160 444 Predicted GTPases [General function prediction onl 99.06
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.05
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.05
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.05
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.04
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.04
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.04
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.04
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.03
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.03
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.03
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.03
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.02
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.02
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.02
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.02
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.02
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.01
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.01
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.01
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.0
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.0
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 99.0
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.0
PRK12297424 obgE GTPase CgtA; Reviewed 99.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.99
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.99
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.99
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.99
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.98
KOG2355291 consensus Predicted ABC-type transport, ATPase com 98.98
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.98
PRK04213201 GTP-binding protein; Provisional 98.98
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.98
PRK09866 741 hypothetical protein; Provisional 98.97
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.97
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.97
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.97
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.97
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.97
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.96
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.96
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.95
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.94
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.94
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.94
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.94
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.94
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.94
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.94
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.94
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.93
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
Probab=99.96  E-value=9.6e-30  Score=223.94  Aligned_cols=145  Identities=26%  Similarity=0.272  Sum_probs=124.8

Q ss_pred             CCCCCCccccccccCCCcEEEEEcCCcchHHHHHHHHHhccCCC-CcEEEEeccCCCCChHHHHHhccccCchhH-----
Q 023913           65 FSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDK-YSLAAVTNDIFTKEDGEFLMRNGALPEERI-----  138 (275)
Q Consensus        65 ~~~~~~~~~~~~~~~~geiv~IiG~nGaGKTTLl~~L~g~l~~~-g~i~i~~~d~~~~~~~~~~~~ig~v~q~~~-----  138 (275)
                      |+++..+.+.++...+|++++|+||||||||||||+|+|+++|. |.|.+++.++.+....++.+.++|+||.+.     
T Consensus        12 y~~~~il~~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~g~l~p~~G~V~l~g~~i~~~~~kelAk~ia~vpQ~~~~~~~~   91 (258)
T COG1120          12 YGGKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGKDIASLSPKELAKKLAYVPQSPSAPFGL   91 (258)
T ss_pred             ECCeeEEecceEEecCCcEEEEECCCCCCHHHHHHHHhccCCCCCCEEEECCCchhhcCHHHHhhhEEEeccCCCCCCCc
Confidence            33466777777777889999999999999999999999999998 999999999999999999999999999852     


Q ss_pred             ---HHHHhcCCCccch-----HHHHHHHHHHHHHhhccccccccccc-ChhHHHHHHHHHHhc-CceEEEEe-CCCCCCc
Q 023913          139 ---RAVETGGCPHAAI-----REDISINLGPLEELSNLFKADLLLCE-SGGDNLAANFSRELA-DYIIYIID-VSGGDKI  207 (275)
Q Consensus       139 ---~~~~~~~~~~~~~-----~~~~~~~~~~L~~l~~~~~~d~~~~e-S~G~~q~~~laral~-~~~vlllD-~t~g~d~  207 (275)
                         +.+.+|..++...     .++.+.+.++|+.+......++.+.+ ||||+||+.|||||+ +|+|++|| ||+.+|.
T Consensus        92 tV~d~V~~GR~p~~~~~~~~~~~D~~~v~~aL~~~~~~~la~r~~~~LSGGerQrv~iArALaQ~~~iLLLDEPTs~LDi  171 (258)
T COG1120          92 TVYELVLLGRYPHLGLFGRPSKEDEEIVEEALELLGLEHLADRPVDELSGGERQRVLIARALAQETPILLLDEPTSHLDI  171 (258)
T ss_pred             EEeehHhhcCCcccccccCCCHhHHHHHHHHHHHhCcHHHhcCcccccChhHHHHHHHHHHHhcCCCEEEeCCCccccCH
Confidence               5667787776543     34555677789988888888888888 999999999999999 89999999 9999986


Q ss_pred             cc
Q 023913          208 PR  209 (275)
Q Consensus       208 ~~  209 (275)
                      ..
T Consensus       172 ~~  173 (258)
T COG1120         172 AH  173 (258)
T ss_pred             HH
Confidence            43



>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
2hf9_A226 Crystal Structure Of Hypb From Methanocaldococcus J 2e-15
2hf8_A226 Crystal Structure Of Hypb From Methanocaldococcus J 2e-14
2wsm_A221 Crystal Structure Of Hydrogenase Maturation Factor 7e-10
>pdb|2HF9|A Chain A, Crystal Structure Of Hypb From Methanocaldococcus Jannaschii In The Triphosphate Form Length = 226 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 61/161 (37%), Positives = 88/161 (54%), Gaps = 13/161 (8%) Query: 88 GPVGTGKTALMLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCP 147 G +G+GKT L+ L L+DKY +A + D+ K D E + ++GA ++ + TG Sbjct: 45 GAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGA----KVVPLNTGKEC 100 Query: 148 HAAIREDISINLGPLEELSNLFKADLLLCESGGDNLA-ANFSRELADYIIYIIDVSGGDK 206 H D + LE+L NL + DLL E+ G+ + A+F I+ I G D Sbjct: 101 HL----DAHLVGHALEDL-NLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDT 155 Query: 207 IPRKGGPGITQ-ADLLVINKTDLASAIGADLAVMERDALRM 246 I + PGI + ADL+VINK DLA A+GAD+ ME DA R+ Sbjct: 156 IEKH--PGIMKTADLIVINKIDLADAVGADIKKMENDAKRI 194
>pdb|2HF8|A Chain A, Crystal Structure Of Hypb From Methanocaldococcus Jannaschii In The Triphosphate Form, In Complex With Zinc Length = 226 Back     alignment and structure
>pdb|2WSM|A Chain A, Crystal Structure Of Hydrogenase Maturation Factor Hypb From Archaeoglobus Fulgidus Length = 221 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
2hf9_A226 Probable hydrogenase nickel incorporation protein 3e-84
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 2e-82
2www_A349 Methylmalonic aciduria type A protein, mitochondri 1e-07
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 2e-05
1pq4_A291 Periplasmic binding protein component of AN ABC T 2e-04
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 4e-04
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Length = 226 Back     alignment and structure
 Score =  250 bits (641), Expect = 3e-84
 Identities = 60/198 (30%), Positives = 89/198 (44%), Gaps = 20/198 (10%)

Query: 71  PILSRN----------FNER-AFTVGIGGPVGTGKTALMLALCKFLRDKYSLAAVTNDIF 119
            IL  N           N+         G +G+GKT L+  L   L+DKY +A +  D+ 
Sbjct: 17  DILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVI 76

Query: 120 TKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESG 179
            K D E + ++GA    ++  + TG   H     D  +    LE+L NL + DLL  E+ 
Sbjct: 77  AKFDAERMEKHGA----KVVPLNTGKECHL----DAHLVGHALEDL-NLDEIDLLFIENV 127

Query: 180 GDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVM 239
           G+ +            I +I  + GD    K    +  ADL+VINK DLA A+GAD+  M
Sbjct: 128 GNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKM 187

Query: 240 ERDALRMRDGGPFIFAQV 257
           E DA R+      +   +
Sbjct: 188 ENDAKRINPDAEVVLLSL 205


>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Length = 221 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Length = 349 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 3nxs_A* 3tk1_A* Length = 355 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Length = 341 Back     alignment and structure
>1pq4_A Periplasmic binding protein component of AN ABC T uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A Length = 291 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.93
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.93
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.93
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.92
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.92
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.92
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.92
1g6h_A257 High-affinity branched-chain amino acid transport 99.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.92
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.92
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.92
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.92
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.92
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.91
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.91
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.91
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.91
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.91
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.91
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.91
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.91
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.91
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.9
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.9
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.9
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.9
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.9
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.9
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.9
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.89
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.89
2ghi_A260 Transport protein; multidrug resistance protein, M 99.89
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.88
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.88
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.87
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.87
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.87
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.87
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.87
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.87
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.87
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.86
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.86
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.82
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.82
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.82
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.81
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.77
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.77
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.76
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.76
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.75
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.75
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.74
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.73
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.71
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.69
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.68
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.68
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.66
2og2_A359 Putative signal recognition particle receptor; nuc 99.65
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.65
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.64
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.64
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.62
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 99.61
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.59
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.56
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.55
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.54
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.51
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.5
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.5
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.49
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.49
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.47
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.46
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.46
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.45
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.44
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.43
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.4
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.4
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.38
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.36
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.3
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.3
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.28
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.25
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.25
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.23
1e69_A322 Chromosome segregation SMC protein; structural mai 99.23
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.21
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.21
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.21
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.18
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.18
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.16
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.16
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.15
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.15
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.13
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.12
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.12
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.12
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.12
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.11
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.11
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.1
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.09
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.09
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.09
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.08
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.08
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.08
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.07
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.07
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.07
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.06
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.06
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.06
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.06
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 99.05
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.05
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.05
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.04
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.04
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.03
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.03
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.03
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.03
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.03
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.03
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.03
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.02
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.02
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.02
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.02
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.01
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.01
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.01
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.0
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.0
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.0
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.0
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.0
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.99
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.99
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.99
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.99
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.99
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.99
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.98
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.98
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.98
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.98
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.98
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.97
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.97
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.97
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.97
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.97
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.97
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 98.97
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.97
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.97
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.97
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.96
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.96
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.96
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.96
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 98.96
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.96
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.96
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.95
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.95
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.95
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.95
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.94
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.94
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.94
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.94
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.94
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.94
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.94
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.94
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.93
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.93
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.93
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.93
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.93
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.92
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.92
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.92
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.92
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.91
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.91
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.91
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.91
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.9
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.9
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.9
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.9
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.89
1p9r_A418 General secretion pathway protein E; bacterial typ 98.89
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.89
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.89
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.89
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.87
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.87
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.87
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.87
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.38
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.86
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.86
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.86
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 98.85
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.85
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.85
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.85
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.85
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.85
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.84
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.84
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.83
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.83
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.83
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.83
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.83
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.83
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.82
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.82
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.82
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.82
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.82
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.8
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.8
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.8
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.79
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.79
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.79
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.79
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.78
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 98.78
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.78
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.78
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.78
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.77
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.77
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.76
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.76
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.75
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.75
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.74
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.74
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.73
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 98.73
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.72
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.72
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.72
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.71
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.7
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 98.69
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.69
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.68
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.68
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.68
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.68
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.67
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.66
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.65
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.65
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.65
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.64
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.64
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.63
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.63
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.63
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.62
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.61
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.61
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.61
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.61
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.6
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.6
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.6
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.59
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.57
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.57
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.57
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.57
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.57
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.55
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.54
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.54
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.54
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.53
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.53
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.51
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.51
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.51
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.5
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.48
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.48
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.47
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 98.47
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.46
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.45
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.45
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.45
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.45
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.45
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.44
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 98.44
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.43
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.42
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.42
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.41
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.41
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.37
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.37
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.36
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.35
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.35
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.32
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.31
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.31
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.3
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.28
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.26
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.26
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.25
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.24
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.24
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.23
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.23
2ged_A193 SR-beta, signal recognition particle receptor beta 98.22
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.17
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.17
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.16
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.15
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.13
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.12
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.09
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.09
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 98.05
3kta_A182 Chromosome segregation protein SMC; structural mai 98.04
2xxa_A 433 Signal recognition particle protein; protein trans 98.0
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.97
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.96
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.93
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.93
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.92
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.92
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.9
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.9
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.89
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.89
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.86
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 97.86
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.81
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.79
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.76
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.76
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.76
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.75
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.7
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.69
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.68
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 97.64
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.59
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.58
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 97.57
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.57
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.56
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.55
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.53
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.52
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.51
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.48
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.44
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.43
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.42
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.35
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.33
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.33
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.32
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.3
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.29
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.29
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.28
3ice_A422 Transcription termination factor RHO; transcriptio 97.2
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.19
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.19
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.18
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.17
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.15
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.14
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.08
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.08
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.08
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.08
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.08
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.07
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.06
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.05
3end_A307 Light-independent protochlorophyllide reductase ir 97.03
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.03
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.98
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.97
3io5_A 333 Recombination and repair protein; storage dimer, i 96.96
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.95
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.94
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.92
1via_A175 Shikimate kinase; structural genomics, transferase 96.92
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.91
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.91
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 96.89
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.89
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.87
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.87
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.87
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.86
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.86
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.86
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 96.86
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.84
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 96.84
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.84
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.83
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.81
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.8
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.79
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.77
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.75
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 96.74
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.74
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 96.72
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.72
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.69
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.68
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 96.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.67
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.65
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.64
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.64
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.63
2z43_A324 DNA repair and recombination protein RADA; archaea 96.63
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.62
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.62
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.59
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.59
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.56
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.56
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.56
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.55
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.55
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.52
3bos_A242 Putative DNA replication factor; P-loop containing 96.52
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.49
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.48
3kta_B173 Chromosome segregation protein SMC; structural mai 96.47
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.47
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.47
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.46
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.43
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.43
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.4
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 96.39
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.37
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 96.37
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.37
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.36
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.36
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.35
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 96.33
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.3
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 96.29
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.29
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.27
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.26
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.25
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.25
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.24
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.23
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.21
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.16
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.15
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.13
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.1
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.07
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.06
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.06
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 96.04
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.03
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.0
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 96.0
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
Probab=99.93  E-value=1.1e-26  Score=207.46  Aligned_cols=152  Identities=14%  Similarity=-0.023  Sum_probs=113.1

Q ss_pred             ccccccCCCCCCCCCCccccccccCCCcEEEEEcCCcchHHHHHHHHHhccCCC-CcEEEEeccCCCC--ChHHHHHhcc
Q 023913           55 SHEPIYSPGYFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDK-YSLAAVTNDIFTK--EDGEFLMRNG  131 (275)
Q Consensus        55 ~~~~~~~~~~~~~~~~~~~~~~~~~~geiv~IiG~nGaGKTTLl~~L~g~l~~~-g~i~i~~~d~~~~--~~~~~~~~ig  131 (275)
                      .+..+.|++   ...++.+.++...+|++++|+||||||||||+++|+|+++|+ |+|.+.+.++...  ....+++.+|
T Consensus        11 ~~ls~~y~~---~~~~L~~isl~i~~Ge~~~iiGpnGsGKSTLl~~l~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~~~ig   87 (275)
T 3gfo_A           11 EELNYNYSD---GTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKLRESIG   87 (275)
T ss_dssp             EEEEEECTT---SCEEEEEEEEEEETTSEEEEECCTTSSHHHHHHHHTTSSCCSEEEEEETTEECCCSHHHHHHHHHSEE
T ss_pred             EEEEEEECC---CCeEEEeeEEEEcCCCEEEEECCCCCCHHHHHHHHHcCCCCCCeEEEECCEECCcccccHHHHhCcEE
Confidence            345566654   344666666677889999999999999999999999999999 9999999887422  2335667899


Q ss_pred             ccCchhH---------HHHHhcCCCc-cchHHHHHHHHHHHHHhhccccccccccc-ChhHHHHHHHHHHhc-CceEEEE
Q 023913          132 ALPEERI---------RAVETGGCPH-AAIREDISINLGPLEELSNLFKADLLLCE-SGGDNLAANFSRELA-DYIIYII  199 (275)
Q Consensus       132 ~v~q~~~---------~~~~~~~~~~-~~~~~~~~~~~~~L~~l~~~~~~d~~~~e-S~G~~q~~~laral~-~~~vlll  199 (275)
                      |+||++.         +++.++.... ....+....+.+.++.+......++.+.+ |+||+||++|||+|+ +|+++|+
T Consensus        88 ~v~Q~~~~~~~~~tv~e~l~~~~~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgGqkQRv~iAraL~~~P~lLlL  167 (275)
T 3gfo_A           88 IVFQDPDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLIL  167 (275)
T ss_dssp             EECSSGGGTCCSSBHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTTCGGGTTSBGGGSCHHHHHHHHHHHHHTTCCSEEEE
T ss_pred             EEEcCcccccccCcHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCCchhhcCCcccCCHHHHHHHHHHHHHHcCCCEEEE
Confidence            9999752         2222221111 11222234456678888777777888888 999999999999999 9999999


Q ss_pred             e-CCCCCCccc
Q 023913          200 D-VSGGDKIPR  209 (275)
Q Consensus       200 D-~t~g~d~~~  209 (275)
                      | |++++|...
T Consensus       168 DEPts~LD~~~  178 (275)
T 3gfo_A          168 DEPTAGLDPMG  178 (275)
T ss_dssp             ECTTTTCCHHH
T ss_pred             ECccccCCHHH
Confidence            9 999998643



>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d2qm8a1323 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylo 3e-25
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 4e-18
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-07
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 0.001
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 0.003
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.004
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Length = 323 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Metallochaperone MeaB
species: Methylobacterium extorquens [TaxId: 408]
 Score =   99 bits (248), Expect = 3e-25
 Identities = 34/199 (17%), Positives = 63/199 (31%), Gaps = 6/199 (3%)

Query: 75  RNFNERAFTVGIGGPVGTGKTALMLALCKFLRD-KYSLAAVTNDIFTKEDGEFLMRNGAL 133
                RA  VGI G  G GK+  + AL   L    + +A +  D  +   G  ++ +   
Sbjct: 45  LPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTR 104

Query: 134 PEERIRAVETGGCPHAAIREDISINLGPLE--ELSNLFKADLLLCESGGDNLAANFSREL 191
                        P  +      +     E   L      D++L E+ G   +     +L
Sbjct: 105 MARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADL 164

Query: 192 ADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGP 251
            D+ + ++    GD++          AD++ +NK D         A        +    P
Sbjct: 165 TDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTP 224

Query: 252 FIFAQVGWVIGIIFTLSIT 270
                  W   ++    + 
Sbjct: 225 ---PSATWTPPVVTISGLH 240


>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.95
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.95
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.94
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.94
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.94
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.94
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.94
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.94
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.93
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.93
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.93
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.93
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.93
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.89
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.87
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.86
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 99.85
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.82
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.79
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.62
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.44
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.33
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.27
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.27
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.26
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.24
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.19
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.17
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.12
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.12
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.08
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.08
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.06
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.05
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.04
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.03
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.02
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.99
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.95
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.93
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.91
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.89
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.88
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.88
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.87
d1okkd2207 GTPase domain of the signal recognition particle r 98.86
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.86
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.85
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.84
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2qy9a2211 GTPase domain of the signal recognition particle r 98.81
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.81
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.79
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.78
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.77
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.73
d1vmaa2213 GTPase domain of the signal recognition particle r 98.72
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.72
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.71
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.7
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.7
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.69
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.68
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.68
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.64
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.57
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.55
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.45
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.43
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.35
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.29
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.27
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.2
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.13
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.12
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.98
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.91
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.86
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.82
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.82
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.68
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.62
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.56
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.54
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.51
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.5
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.49
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.47
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.43
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.43
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.43
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.41
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.39
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.36
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.31
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.31
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.3
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 97.25
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.25
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.23
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.22
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.18
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.18
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.17
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.15
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.15
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.08
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.06
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.06
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 97.05
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 97.04
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.02
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.02
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.0
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.99
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.98
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.96
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.93
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.93
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.92
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.89
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.89
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.88
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.88
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.86
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.85
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.83
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.82
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.8
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 96.77
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.74
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.7
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.68
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.66
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.66
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.65
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.65
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.54
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.54
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.54
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.49
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.48
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.47
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.46
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.44
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.43
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.43
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.43
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.38
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.34
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.32
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.31
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.3
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.29
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.29
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 96.26
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.11
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.09
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.08
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.99
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.95
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.87
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.85
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.78
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.77
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.68
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.65
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.58
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.57
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.57
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.55
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.54
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.5
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.5
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 95.46
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.41
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.4
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.4
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.35
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 95.29
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.26
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.26
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.25
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.16
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 95.13
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.09
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 95.03
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.02
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.99
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.98
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.94
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.88
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.77
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.65
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.44
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.35
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.31
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.3
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.11
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.83
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 93.77
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.77
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.63
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.46
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.46
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.44
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.19
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.15
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.1
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.05
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.74
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.7
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.58
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.56
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 92.46
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.28
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.06
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.03
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.81
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 91.74
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.74
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 91.21
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.84
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.65
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.13
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 89.9
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.57
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 89.5
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.03
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.94
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 88.9
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 88.57
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.52
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 88.46
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 88.21
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 87.85
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.82
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 87.59
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 86.67
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.31
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 85.07
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 85.01
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.92
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.78
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.24
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 82.67
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.52
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 82.32
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 82.23
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 81.77
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 81.62
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 81.11
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.06
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.95  E-value=1.5e-28  Score=212.34  Aligned_cols=145  Identities=11%  Similarity=-0.045  Sum_probs=113.3

Q ss_pred             CCCCCCCccccccccCCCcEEEEEcCCcchHHHHHHHHHhccCCC-CcEEEEeccCCCCChHHHHHhccccCchhH----
Q 023913           64 YFSRRAPPILSRNFNERAFTVGIGGPVGTGKTALMLALCKFLRDK-YSLAAVTNDIFTKEDGEFLMRNGALPEERI----  138 (275)
Q Consensus        64 ~~~~~~~~~~~~~~~~~geiv~IiG~nGaGKTTLl~~L~g~l~~~-g~i~i~~~d~~~~~~~~~~~~ig~v~q~~~----  138 (275)
                      +|++.+++.++++...+|++++|+||||||||||+++|+|+++|+ |+|.+.+.++....+.  ++++||+||++.    
T Consensus        15 ~yg~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~~~~~--~r~ig~v~Q~~~l~~~   92 (239)
T d1v43a3          15 RFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPK--DRNISMVFQSYAVWPH   92 (239)
T ss_dssp             EETTEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCGG--GGTEEEEEC------C
T ss_pred             EECCEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCCCCCCEEEEcceecccCCcc--cceEEEEeechhhccc
Confidence            344677777888888999999999999999999999999999999 9999999998765543  467999999973    


Q ss_pred             ----HHHHhcCCCcc-chHHHHHHHHHHHHHhhccccccccccc-ChhHHHHHHHHHHhc-CceEEEEe-CCCCCCcccc
Q 023913          139 ----RAVETGGCPHA-AIREDISINLGPLEELSNLFKADLLLCE-SGGDNLAANFSRELA-DYIIYIID-VSGGDKIPRK  210 (275)
Q Consensus       139 ----~~~~~~~~~~~-~~~~~~~~~~~~L~~l~~~~~~d~~~~e-S~G~~q~~~laral~-~~~vlllD-~t~g~d~~~~  210 (275)
                          +++.+...... ...+....+.+.|+.+......++.+.+ |+||+||++|||+|+ +|+|+|+| ||+++|+..+
T Consensus        93 ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllDEPts~LD~~~~  172 (239)
T d1v43a3          93 MTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLR  172 (239)
T ss_dssp             CCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEEESTTTTSCHHHH
T ss_pred             chHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCChhhhcCChhhCCHHHHHHHHHHhhhccCCCceeecCCcccCCHHHH
Confidence                23333322222 2223334566788888888888888888 999999999999999 99999999 9999997543



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure