Citrus Sinensis ID: 023919

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----

MVSWNSVPLEITYQVLGWISFVAWSVSFYPQVILNFRRKSVVGLNFDFVLLNLTKHSSYMIYNVVLFFSSTVQQQYFQKYGRDQMIPVAANDVAFSMHAVLLTIITLFQIAIYERGVQKVSKISMAIVSVVWLAAAVCFFVALPNHSWLWLINFFNAIQVIMTLIKYIPQAIMNFRRKSTDGFSIGNILLDFLGGCTNYSQMIVQSIDQNSWVNFYGNIGKTLLSLVSVVFDLLFICQHYVLYPAKKAVISSKLSKDGGVEPLLKSSDHPESENV

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc

***WNSVPLEITYQVLGWISFVAWSVSFYPQVILNFRRKSVVGLNFDFVLLNLTKHSSYMIYNVVLFFSSTVQQQYFQKYGRDQMIPVAANDVAFSMHAVLLTIITLFQIAIYERGVQKVSKISMAIVSVVWLAAAVCFFVALPNHSWLWLINFFNAIQVIMTLIKYIPQAIMNFRRKSTDGFSIGNILLDFLGGCTNYSQMIVQSIDQNSWVNFYGNIGKTLLSLVSVVFDLLFICQHYVLYPAK*****************************

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cystinosin homolog	Thought to transport cystine out of lysosomes.	probable	P57758
Cystinosin homolog	Thought to transport cystine out of lysosomes.	probable	Q54WT7
Cystine transporter	Transport cystine out of vacuoles/endodomes.	probable	P17261

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted