Citrus Sinensis ID: 023921

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
cccEEEEEEcccccHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHccccccEEEEEEccccEEEEEEcccHHHHHHHHHHHcccEEEEccccccccHHHHHHHccccccccEEEEEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccEEEEEcccEEEEEccc
cHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHccccccEEEEEccccEEEEEccccHHHHHHHHHHccccEEEEccccccHHHHHHHEEEEcccccccEEEEEEEccccEEEEEEEEccccEEcEEEEEccccccccccccccEcccccccccccccEEEEEEEEEEEEEEEEEHHHHHHccEEEEEcccc
MAILRTVATLATATTTTAVAafafpsssssfsskshqpksqnlsffssqslsllysnksplvknfsnppsalpmdaptsdhkntsqgdqglpELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKarlvgqgvpeDFLVSAAVaefkgpdvfGVVRLAQVNMELARIEAnfsglspgkhgwsinefgdltkgavstgrvynpkiegsakeVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTgvknvevdlsnqvvrilgssplkTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
MAILRtvatlatattttavaafafpsssssfssKSHQPksqnlsffssqslsllysnksPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
***LRTVATLATATTTTAVAAFAF********************************************************************ELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLK**********RKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFM***
***LRT*ATLATATTTTAVAAFAF**********************************************************************LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVY****************LCSTYYFSFICVHESVVDEMGISICFMMP*
MAILRTVATLATATTTTAVAAFAFP*****************LSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMD************DQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
*AILRTVATLATATTTTAVAAF**********************************NKSPLVKN************************QGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFSVFLCSTYYFSFICVHESVVDEMGISICFMMPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
Q9JK72274 Copper chaperone for supe yes no 0.490 0.492 0.441 2e-22
Q9WU84274 Copper chaperone for supe yes no 0.490 0.492 0.426 5e-22
O14618274 Copper chaperone for supe yes no 0.490 0.492 0.433 8e-22
Q6PWT7274 Copper chaperone for supe yes no 0.498 0.5 0.427 2e-21
Q75DD6238 Superoxide dismutase 1 co yes no 0.469 0.542 0.366 3e-14
Q6BK66250 Superoxide dismutase 1 co yes no 0.472 0.52 0.319 9e-13
Q6BZU2234 Superoxide dismutase 1 co yes no 0.483 0.568 0.307 4e-12
Q6CIG2245 Superoxide dismutase 1 co yes no 0.469 0.526 0.315 9e-12
P40202249 Superoxide dismutase 1 co yes no 0.483 0.534 0.283 3e-10
Q6FU61239 Superoxide dismutase 1 co yes no 0.476 0.548 0.302 1e-09
>sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 97  EYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR 156
           E+ V M C+ CVDAV + L+   GV+NVEV L NQ+V +  + P + +   LE TGR+A 
Sbjct: 15  EFTVQMSCQSCVDAVHKTLKGAAGVQNVEVQLENQMVLVQTTLPSQEVQALLESTGRQAV 74

Query: 157 LVGQGVPEDFLVSAAVAEFKGPD-VFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEF 215
           L G G  +   + AAVA  +G   V GVVR  Q++ EL  IE    GL PG HG  ++++
Sbjct: 75  LKGMGSSQLKNLGAAVAIMEGSGTVQGVVRFLQLSSELCLIEGTIDGLEPGLHGLHVHQY 134

Query: 216 GDLTKGAVSTGRVYNP 231
           GDLTK   S G  +NP
Sbjct: 135 GDLTKDCSSCGDHFNP 150
Delivers copper to copper zinc superoxide dismutase (SOD1).
Rattus norvegicus (taxid: 10116)
>sp|Q9WU84|CCS_MOUSE Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1 Back     alignment and function description
>sp|O14618|CCS_HUMAN Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1 Back     alignment and function description
>sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 Back     alignment and function description
>sp|Q75DD6|CCS1_ASHGO Superoxide dismutase 1 copper chaperone OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCS1 PE=3 SV=2 Back     alignment and function description
>sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|P40202|CCS1_YEAST Superoxide dismutase 1 copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q6FU61|CCS1_CANGA Superoxide dismutase 1 copper chaperone OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
345106302319 copper/zinc-superoxide dismutase copper 0.821 0.708 0.718 8e-87
344190168323 Cu/Zn-superoxide dismutase copper chaper 0.843 0.718 0.686 2e-86
255537177330 superoxide dismutase copper chaperone, p 0.650 0.542 0.822 2e-81
351722110304 Cu/Zn-superoxide dismutase copper chaper 0.789 0.713 0.669 6e-80
449460453328 PREDICTED: copper chaperone for superoxi 0.818 0.685 0.672 1e-77
224074743323 predicted protein [Populus trichocarpa] 0.650 0.554 0.765 1e-77
256002663314 copper/zinc superoxide dismutase copper 0.654 0.573 0.770 2e-77
357476979312 Cu/Zn-superoxide dismutase copper chaper 0.807 0.711 0.648 1e-76
37654464312 copper chaperone precursor [Solanum tube 0.698 0.615 0.704 4e-75
225426700322 PREDICTED: copper chaperone for superoxi 0.694 0.593 0.700 2e-74
>gi|345106302|gb|AEN71836.1| copper/zinc-superoxide dismutase copper chaperone precursor [Dimocarpus longan] Back     alignment and taxonomy information
 Score =  326 bits (835), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 171/238 (71%), Positives = 188/238 (78%), Gaps = 12/238 (5%)

Query: 37  QPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLT 96
           +P SQNLS FS QSLSL    + PLVKNF+N PSAL MDAPTS+H++  Q    LPELLT
Sbjct: 37  KPPSQNLSVFSPQSLSL----RLPLVKNFTNSPSALHMDAPTSNHQDDHQV---LPELLT 89

Query: 97  EYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR 156
           EYMVDMKCEGCV+AVK KLQTV GVKNVEVDLSNQVVRILG SP+KTMTEALEQTGRKAR
Sbjct: 90  EYMVDMKCEGCVNAVKNKLQTVNGVKNVEVDLSNQVVRILGWSPVKTMTEALEQTGRKAR 149

Query: 157 LVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFG 216
           L+GQGVPEDFLVSAAVAEFKGPD+FGVVRLAQVNMELAR EANF+GLSPGKHGWSINE+G
Sbjct: 150 LIGQGVPEDFLVSAAVAEFKGPDIFGVVRLAQVNMELARGEANFTGLSPGKHGWSINEYG 209

Query: 217 DLTKGAVSTGRVYNPKIEGSAKEV-----CFSVFLCSTYYFSFICVHESVVDEMGISI 269
           DLT GA STG+VYNP    + KE         V      +FS +     VVD +G SI
Sbjct: 210 DLTNGAASTGKVYNPTSLETVKEPLGDLGTLEVDDKGEAFFSGVKEKLRVVDLIGRSI 267

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|344190168|gb|AEM97866.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Corylus heterophylla] Back     alignment and taxonomy information
>gi|255537177|ref|XP_002509655.1| superoxide dismutase copper chaperone, putative [Ricinus communis] gi|223549554|gb|EEF51042.1| superoxide dismutase copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722110|ref|NP_001235441.1| Cu/Zn-superoxide dismutase copper chaperone [Glycine max] gi|12711645|gb|AAK01931.1|AF329816_1 Cu/Zn-superoxide dismutase copper chaperone precursor [Glycine max] Back     alignment and taxonomy information
>gi|449460453|ref|XP_004147960.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] gi|449524344|ref|XP_004169183.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074743|ref|XP_002304450.1| predicted protein [Populus trichocarpa] gi|222841882|gb|EEE79429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|256002663|gb|ACU52585.1| copper/zinc superoxide dismutase copper chaperone precursor [Caragana jubata] Back     alignment and taxonomy information
>gi|357476979|ref|XP_003608775.1| Cu/Zn-superoxide dismutase copper chaperone [Medicago truncatula] gi|355509830|gb|AES90972.1| Cu/Zn-superoxide dismutase copper chaperone [Medicago truncatula] gi|388508416|gb|AFK42274.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|37654464|gb|AAP34306.1| copper chaperone precursor [Solanum tuberosum] Back     alignment and taxonomy information
>gi|225426700|ref|XP_002281850.1| PREDICTED: copper chaperone for superoxide dismutase-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
TAIR|locus:2034740320 CCS "AT1G12520" [Arabidopsis t 0.607 0.521 0.713 1e-61
UNIPROTKB|Q7XTY9312 OSJNBa0019K04.8 "Os04g0573200 0.592 0.522 0.704 1.5e-58
RGD|620403274 Ccs "copper chaperone for supe 0.534 0.536 0.429 6.8e-24
MGI|MGI:1333783274 Ccs "copper chaperone for supe 0.534 0.536 0.416 1.8e-23
UNIPROTKB|E9PK03249 CCS "Copper chaperone for supe 0.530 0.586 0.426 4.8e-23
UNIPROTKB|O14618274 CCS "Copper chaperone for supe 0.530 0.532 0.426 4.8e-23
UNIPROTKB|E1BE86274 CCS "Uncharacterized protein" 0.52 0.521 0.427 1.3e-22
UNIPROTKB|Q2KHY4216 CCS "Copper chaperone for supe 0.52 0.662 0.427 1.3e-22
UNIPROTKB|F1RUT5178 CCS "Copper chaperone for supe 0.498 0.769 0.427 1.6e-22
UNIPROTKB|Q6PWT7274 CCS "Copper chaperone for supe 0.498 0.5 0.427 1.6e-22
TAIR|locus:2034740 CCS "AT1G12520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 631 (227.2 bits), Expect = 1.0e-61, P = 1.0e-61
 Identities = 122/171 (71%), Positives = 145/171 (84%)

Query:    61 LVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTG 120
             L ++F + P A  +   TSD +N  Q D+ +P+LLTE+MVDM CEGCV+AVK KL+T+ G
Sbjct:    58 LSRSFVSSPMATAL---TSD-RNLHQEDRAMPQLLTEFMVDMTCEGCVNAVKNKLETIEG 113

Query:   121 VKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDV 180
             ++ VEVDLSNQVVRILGSSP+K MT+ALEQTGRKARL+GQGVP+DFLVSAAVAEFKGPD+
Sbjct:   114 IEKVEVDLSNQVVRILGSSPVKAMTQALEQTGRKARLIGQGVPQDFLVSAAVAEFKGPDI 173

Query:   181 FGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNP 231
             FGVVR AQV+MELARIEANF+GLSPG H W INE+GDLT GA STG +YNP
Sbjct:   174 FGVVRFAQVSMELARIEANFTGLSPGTHSWCINEYGDLTNGAASTGSLYNP 224
GO:0005622 "intracellular" evidence=IBA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006801 "superoxide metabolic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015680 "intracellular copper ion transport" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006878 "cellular copper ion homeostasis" evidence=TAS
GO:0016532 "superoxide dismutase copper chaperone activity" evidence=IGI;IMP
GO:0009570 "chloroplast stroma" evidence=IDA
UNIPROTKB|Q7XTY9 OSJNBa0019K04.8 "Os04g0573200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
RGD|620403 Ccs "copper chaperone for superoxide dismutase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1333783 Ccs "copper chaperone for superoxide dismutase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PK03 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O14618 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE86 CCS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHY4 CCS "Copper chaperone for superoxide dismutase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUT5 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PWT7 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.1LOW CONFIDENCE prediction!
3rd Layer1.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00001050001
SubName- Full=Chromosome chr2 scaffold_112, whole genome shotgun sequence; (253 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00008877001
RecName- Full=Superoxide dismutase [Cu-Zn]; EC=1.15.1.1;; Destroys radicals which are normally [...] (158 aa)
  ••• ••0.415
GSVIVG00025465001
RecName- Full=Superoxide dismutase [Cu-Zn]; EC=1.15.1.1;; Destroys radicals which are normally [...] (165 aa)
  ••• ••0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 3e-96
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 1e-15
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 4e-12
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 3e-09
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 6e-09
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 1e-07
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 1e-06
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 2e-05
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 6e-05
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information 
 Score =  282 bits (723), Expect = 3e-96
 Identities = 120/149 (80%), Positives = 134/149 (89%)

Query: 91  LPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQ 150
           LPELLTE+MVDMKCEGCV AVK KL+T+ GVK VEVDLSNQVVR+LGSSP+K MT ALEQ
Sbjct: 3   LPELLTEFMVDMKCEGCVAAVKNKLETLEGVKAVEVDLSNQVVRVLGSSPVKAMTAALEQ 62

Query: 151 TGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGW 210
           TGRKARL+GQG PEDFLVSAAVAEFKGPD+FGVVR AQV+MELARIEA FSGLSPG HGW
Sbjct: 63  TGRKARLIGQGDPEDFLVSAAVAEFKGPDIFGVVRFAQVSMELARIEAAFSGLSPGTHGW 122

Query: 211 SINEFGDLTKGAVSTGRVYNPKIEGSAKE 239
           SINE+GDLT+GA STG+VYNP  + + +E
Sbjct: 123 SINEYGDLTRGAASTGKVYNPSDDDTDEE 151

Length = 238
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
KOG4656247 consensus Copper chaperone for superoxide dismutas 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
PLN02642164 copper, zinc superoxide dismutase 99.92
PLN02386152 superoxide dismutase [Cu-Zn] 99.92
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 99.89
PRK15388177 Cu/Zn superoxide dismutase; Provisional 99.87
PRK10290173 superoxide dismutase; Provisional 99.86
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 99.86
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 99.81
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 99.8
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.3
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.21
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.57
PRK10671 834 copA copper exporting ATPase; Provisional 98.05
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.91
TIGR0000368 copper ion binding protein. This model describes a 97.59
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.46
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.36
PRK10671 834 copA copper exporting ATPase; Provisional 96.74
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.72
TIGR0205292 MerP mercuric transport protein periplasmic compon 92.9
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 87.34
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 87.25
PRK13748 561 putative mercuric reductase; Provisional 84.2
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-39  Score=277.74  Aligned_cols=174  Identities=39%  Similarity=0.556  Sum_probs=159.9

Q ss_pred             CceEEEEEecCcChhhHHHHHHHHhCCCCeeEEEEEcCCcEEEEEeCCCHHHHHHHHHhcCCceEEeCCCCCccccccce
Q 023921           92 PELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAA  171 (275)
Q Consensus        92 ~~~~v~~~VGM~C~~C~~~IekaL~~l~GV~~v~Vdl~~~~v~V~~~~~~~~I~~aI~~~Gy~a~l~~~g~~~~~~~~~A  171 (275)
                      +..+++|.|.|+|++|++.|++.|+.++||.+++||+..+.+.|....++.+|.+.|+.+|.++.+++.|.+..+++.++
T Consensus         5 ~~~~~efaV~M~cescvnavk~~L~~V~Gi~~vevdle~q~v~v~ts~p~s~i~~~le~tGr~Avl~G~G~psaval~at   84 (247)
T KOG4656|consen    5 DTYEAEFAVQMTCESCVNAVKACLKGVPGINSVEVDLEQQIVSVETSVPPSEIQNTLENTGRDAVLRGAGKPSAVALLAT   84 (247)
T ss_pred             CceeEEEEEechhHHHHHHHHHHhccCCCcceEEEEhhhcEEEEEccCChHHHHHHHHhhChheEEecCCchhHHHHHHH
Confidence            34678899999999999999999999999999999999999999999999999999999999999999999988888999


Q ss_pred             eeeecCC-ceeeEEEEeeecCccEEEEEEecCCCCCccceEEcccCCCCCCccccCCCcCCCCCCCCCCCCcc---eeec
Q 023921          172 VAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVCFS---VFLC  247 (275)
Q Consensus       172 va~~~G~-~v~G~v~~~q~~~~~~~v~~~i~GL~~g~hg~HIHe~Gd~~~g~~saGgh~np~~~~hg~~~~g~---l~~~  247 (275)
                      ++.+.|+ .|+|.|||.|...+.++|++++.||+||.||+||||+||+++||.|+|.||||++.+||....||   +-.|
T Consensus        85 ~a~~~~~~~v~GvvRf~qvt~ek~lid~tvdGlspG~h~~~Ihe~GDlsng~~StG~~ynpf~~p~g~~~~gDLGn~~ad  164 (247)
T KOG4656|consen   85 VAKYTGPQAVQGVVRFVQVTEEKTLIDGTVDGLSPGLHGLHIHEYGDLSNGCESTGKHYNPFQEPHGCPNEGDLGNNRAD  164 (247)
T ss_pred             HHHhcCCccceeEEEEEEeccccEEEEEEecCCCCcccceeEeeccccccchhhcccccCCCcCCCCCCCcccccccccc
Confidence            9999998 79999999999988999999999999999999999999999999999999999999998755444   2222


Q ss_pred             -----------CceeEeeeeceeeEEecC
Q 023921          248 -----------STYYFSFICVHESVVDEM  265 (275)
Q Consensus       248 -----------~~~~~~~~~gr~~vih~~  265 (275)
                                 ..+++|++|||++||+..
T Consensus       165 ~nGraf~s~~de~LkvwdlIGRsvVi~k~  193 (247)
T KOG4656|consen  165 KNGRAFFSAPDEKLKVWDLIGRSVVISKS  193 (247)
T ss_pred             cCCcEEEecccccccHhhhhceeEEEecc
Confidence                       248899999999999654

>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
1jk9_B249 Heterodimer Between H48f-Ysod1 And Yccs Length = 24 3e-11
1qup_A222 Crystal Structure Of The Copper Chaperone For Super 2e-10
2crl_A98 The Apo Form Of Hma Domain Of Copper Chaperone For 3e-09
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 4e-08
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 2e-07
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 3e-07
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 7e-07
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 5e-06
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 9e-06
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 3e-05
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 5e-05
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 5e-05
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 6e-05
3cjk_A68 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 1e-04
1fe4_A68 Crystal Structure Of Mercury-Hah1 Length = 68 2e-04
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 2e-04
>pdb|1JK9|B Chain B, Heterodimer Between H48f-Ysod1 And Yccs Length = 249 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 8/141 (5%)
Query: 98  YMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARL 157
           Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A +
Sbjct: 11  YAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAII 70
Query: 158 VGQGVPEDFLVSA-------AVAEFKGPDVFGVVRLAQVNMELARIEANFSGL-SPGKHG 209
            G G P    V+         + + K   V G+ R+ QV       +   +G+   G + 
Sbjct: 71  RGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYH 130
Query: 210 WSINEFGDLTKGAVSTGRVYN 230
            SI+E GD++KG  STG+V++
Sbjct: 131 ASIHEKGDVSKGVESTGKVWH 151
>pdb|1QUP|A Chain A, Crystal Structure Of The Copper Chaperone For Superoxide Dismutase Length = 222 Back     alignment and structure
>pdb|2CRL|A Chain A, The Apo Form Of Hma Domain Of Copper Chaperone For Superoxide Dismutase Length = 98 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|3CJK|A Chain A, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 68 Back     alignment and structure
>pdb|1FE4|A Chain A, Crystal Structure Of Mercury-Hah1 Length = 68 Back     alignment and structure
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 1e-35
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 2e-32
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 9e-24
1do5_A154 Human copper chaperone for superoxide dismutase do 6e-21
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 8e-18
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 6e-17
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 2e-15
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 3e-15
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 4e-15
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 5e-14
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 5e-14
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 2e-13
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 8e-13
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 1e-12
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 1e-12
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 2e-12
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 5e-12
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 8e-12
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 1e-10
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 1e-10
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 5e-10
1yg0_A66 COP associated protein; open-faced beta-sandwich, 3e-08
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 6e-08
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 9e-08
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 5e-07
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 6e-07
2kyz_A67 Heavy metal binding protein; structural genomics, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 1e-06
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 2e-06
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 2e-06
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 2e-06
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 3e-06
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 4e-06
2kkh_A95 Putative heavy metal transporter; zinc transport, 1e-05
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 1e-05
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 2e-05
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 2e-05
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1e-04
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 2e-04
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 2e-04
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 5e-04
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 2e-04
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-04
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 3e-04
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 3e-04
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 4e-04
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 5e-04
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 5e-04
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 7e-04
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 7e-04
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 8e-04
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
 Score =  126 bits (317), Expect = 1e-35
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 8/144 (5%)

Query: 96  TEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKA 155
             Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A
Sbjct: 8   ATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDA 67

Query: 156 RLVGQGVPEDFLVS-------AAVAEFKGPDVFGVVRLAQVNMELARIEANFSGL-SPGK 207
            + G G P    V+         + + K   V G+ R+ QV       +   +G+   G 
Sbjct: 68  IIRGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGN 127

Query: 208 HGWSINEFGDLTKGAVSTGRVYNP 231
           +  SI+E GD++KG  STG+V++ 
Sbjct: 128 YHASIHEKGDVSKGVESTGKVWHK 151
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 99.94
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 99.93
1do5_A154 Human copper chaperone for superoxide dismutase do 99.93
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 99.93
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 99.93
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 99.93
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 99.93
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 99.93
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 99.92
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 99.92
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 99.92
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 99.92
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 99.92
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 99.91
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 99.89
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 99.89
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 99.88
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 99.88
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 99.88
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 99.87
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 99.87
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 99.87
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 99.86
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.37
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.31
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.29
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.28
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.19
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.18
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.12
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.12
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.1
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.1
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.1
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.09
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.09
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.08
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.07
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.07
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.06
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.06
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.05
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.04
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.03
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.03
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.02
2kyz_A67 Heavy metal binding protein; structural genomics, 99.01
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.0
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.0
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.99
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.98
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.97
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.91
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.89
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.88
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.87
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.78
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.72
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.7
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.37
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.37
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.34
3lvj_C82 Sulfurtransferase TUSA; protein-protein complex, s 82.1
1jdq_A98 TM006 protein, hypothetical protein TM0983; struct 80.26
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
Probab=100.00  E-value=2.6e-39  Score=286.16  Aligned_cols=167  Identities=27%  Similarity=0.380  Sum_probs=148.6

Q ss_pred             eEEEEEecCcChhhHHHHHHHHhCCCCeeEEEEEcCCcEEEEEeCCCHHHHHHHHHhcCCceEEeCCCCCccccccceee
Q 023921           94 LLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVA  173 (275)
Q Consensus        94 ~~v~~~VGM~C~~C~~~IekaL~~l~GV~~v~Vdl~~~~v~V~~~~~~~~I~~aI~~~Gy~a~l~~~g~~~~~~~~~Ava  173 (275)
                      .+++|.|.|+|..|+.+|+++|++++||.++++|+..++++|.+...+++|.++|+++||++.++..+.++    .+|||
T Consensus         6 ~~~~l~V~MtC~~Ca~~IekaL~~l~GV~~v~Vnl~~~~v~V~~~~~~~~I~~aI~~~Gy~a~~~~~~~~~----~~av~   81 (222)
T 1qup_A            6 YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPN----SSAVA   81 (222)
T ss_dssp             EEEEEECCCCSTTHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHHTTCCCEEECCSCTT----CEEEE
T ss_pred             eEEEEEEccccHHHHHHHHHHHhcCCCeeEEEEEcCCCEEEEeccCCHHHHHHHHHHcCCccccccCCCcc----ceeeE
Confidence            45678888999999999999999999999999999999999998888999999999999999999888776    68999


Q ss_pred             eecCC-----------ceeeEEEEeeecCccEEEEEEecCCC-CCccceEEcccCCCCCCccccCCCcCCCCCCCCCCCC
Q 023921          174 EFKGP-----------DVFGVVRLAQVNMELARIEANFSGLS-PGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEVC  241 (275)
Q Consensus       174 ~~~G~-----------~v~G~v~~~q~~~~~~~v~~~i~GL~-~g~hg~HIHe~Gd~~~g~~saGgh~np~~~~hg~~~~  241 (275)
                      ++++.           ++.|+|+|+|..+++++|+++|+||+ ||+|||||||+|||++||.||||||||.+++||.  +
T Consensus        82 ~l~~~~~~~~~~~~~~~v~G~v~~~q~~~~~~~v~~~i~GL~~~g~hg~hiHe~Gd~~~g~~saG~h~np~~~~hGD--l  159 (222)
T 1qup_A           82 ILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPIEC--F  159 (222)
T ss_dssp             EEECCSCCSSCCCCSCCEEEEEEEEECSSSCEEEEEEEEEESSCEEEEEEEESCCCCTTGGGGGCSEEEECCSCEEE--C
T ss_pred             EeccccccccccccCCCceEEEEEEEecCCCEEEEEEEeCCCCCCcEeEEEcCCCCCCCCcccccCCcCCCCCccCc--c
Confidence            99874           59999999997556899999999999 9999999999999999999999999999999963  4


Q ss_pred             cceeecC-----------ceeEeeeeceeeEEecCC
Q 023921          242 FSVFLCS-----------TYYFSFICVHESVVDEMG  266 (275)
Q Consensus       242 g~l~~~~-----------~~~~~~~~gr~~vih~~G  266 (275)
                      |+|+++.           .+++|+++||++|||+..
T Consensus       160 gni~~~~~~G~a~~~~~~~~~l~~iiGrs~vvh~~~  195 (222)
T 1qup_A          160 NESDLGKNLYSGKTFLSAPLPTWQLIGRSFVISKSL  195 (222)
T ss_dssp             EEETTEEEEEEEEEEEEESCCHHHHTTSEEEEEEEC
T ss_pred             CCEEecCCCcEEEEEECCCcCccccCCeEEEEEcCC
Confidence            5555443           466788899999998753
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A Back     alignment and structure
>1jdq_A TM006 protein, hypothetical protein TM0983; structural genomics; NMR {Thermotoga maritima} SCOP: d.68.3.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 5e-13
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 7e-13
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-12
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 2e-11
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 4e-11
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 1e-10
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 4e-10
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 5e-10
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 8e-10
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 2e-09
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 5e-09
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 5e-09
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 7e-09
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 3e-08
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 4e-08
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 5e-08
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 2e-07
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 3e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 5e-07
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 5e-07
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 6e-07
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 7e-07
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 7e-07
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 2e-06
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 3e-06
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 5e-06
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 60.6 bits (147), Expect = 5e-13
 Identities = 18/64 (28%), Positives = 32/64 (50%)

Query: 96  TEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKA 155
             Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A
Sbjct: 8   ATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDA 67

Query: 156 RLVG 159
            + G
Sbjct: 68  IIRG 71
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 99.93
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 99.92
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 99.92
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 99.92
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 99.91
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 99.9
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 99.9
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 99.89
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 99.87
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 99.86
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 99.86
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 99.78
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.56
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.54
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.48
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.47
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.45
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.45
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.45
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.44
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.41
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.4
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.4
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.39
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.38
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.37
d1jdqa_98 Hypothetical protein TM0983 {Thermotoga maritima [ 85.28
d1dcja_81 SirA {Escherichia coli [TaxId: 562]} 81.99
d1je3a_97 hypothetical protein YedF (EC005) {Escherichia col 81.15
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Copper chaperone for superoxide dismutase, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.93  E-value=8.2e-28  Score=196.04  Aligned_cols=97  Identities=27%  Similarity=0.293  Sum_probs=81.6

Q ss_pred             cceeeeec-----------CCceeeEEEEeeecCccEEEEEEecCCC-CCccceEEcccCCCCCCccccCCCcCCCCCCC
Q 023921          169 SAAVAEFK-----------GPDVFGVVRLAQVNMELARIEANFSGLS-PGKHGWSINEFGDLTKGAVSTGRVYNPKIEGS  236 (275)
Q Consensus       169 ~~Ava~~~-----------G~~v~G~v~~~q~~~~~~~v~~~i~GL~-~g~hg~HIHe~Gd~~~g~~saGgh~np~~~~h  236 (275)
                      ++|||+|.           +..|+|+|||+|..++.++|+++|+||| ||+|||||||+|||++||.|+|+||||++++|
T Consensus         1 s~av~ile~~~~~~~~~k~~~~V~G~vrf~q~~~~~~~v~~~i~GL~~pg~hg~hIHe~GDls~Gc~SaG~hfnp~~~~h   80 (140)
T d1ej8a_           1 SSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPI   80 (140)
T ss_dssp             CEEEEEEECCSCCTTCCCCSCCEEEEEEEEEEETTEEEEEEEEEEESSCEEEEEEEESCCCCTTGGGGSCSEEEECCSCE
T ss_pred             CceEEEeeecccceeeccCCCcceEEEEEEEECCCCEEEEEEEECCCCCCcccEEEecCCCCCCChhhcccccCCcCCCC
Confidence            35677664           3479999999998777899999999996 79999999999999999999999999999999


Q ss_pred             CCCC------Cc---ceeecCceeEeeeeceeeEEecC
Q 023921          237 AKEV------CF---SVFLCSTYYFSFICVHESVVDEM  265 (275)
Q Consensus       237 g~~~------~g---~l~~~~~~~~~~~~gr~~vih~~  265 (275)
                      |..+      .|   ..|.+.++++|+++||++|||+.
T Consensus        81 Gdlgn~~~~~~G~~~~~~~~~~~~l~~iiGRsiVIH~~  118 (140)
T d1ej8a_          81 ECFNESDLGKNLYSGKTFLSAPLPTWQLIGRSFVISKS  118 (140)
T ss_dssp             EECEEEETTTTEEEEEEEEEESCCGGGTTTSEEEEEEE
T ss_pred             CcCCceeeccCCeEEEEEEcCCccceeecCcEEEEEec
Confidence            7532      11   24555678899999999999863
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure