Citrus Sinensis ID: 023945

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MASGLRRFVGSLSRRNLSTACANKQLIQQHDGGVGSGKSLNLYSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKVCDSFSLLENVFF
cccccHHHHcccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHcccccEEEEEccccHHcHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccHHHHHHcccccEEEccccHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccEEEEECcccEEEEEEcHHHHHHHHHHHHHHHccccEEEEEcccc
**********************************GSGKSLNLYSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKVCDSFSLLENVFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGLRRFVGSLSRRNLSTACANKQLIQQHDGGVGSGKSLNLYSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKVCDSFSLLENVFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-oxoisovalerate dehydrogenase subunit beta The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).probableP37941
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).probableP35738
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).probableP21839

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.2.-.-Acting on the aldehyde or oxo group of donors.probable
1.2.4.-2,4'-dihydroxyacetophenone dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BFD, chain B
Confidence level:very confident
Coverage over the Query: 35-274
View the alignment between query and template
View the model in PyMOL