Citrus Sinensis ID: 023956

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MALAASSSSSLAAKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVSLPQEVECVDKK
ccccccccccHHHHHccccccccccccccccccccccccccccccccEEEccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEccHHHHHHHHccccccccHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHccEEEEccHHHHHcHHcHHHHHcccccccccccEEEEEccc
malaasssSSLAAKQLAGlitssscytkstASLVklgcisprtkrslkvsaavdansmpltgvvfqpFEEVKkevldvpvspllsLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQnlrggkvklhsimqppsefdhaekgDALYAMELALSLEKLTNEKLLSLHsvadrnndpqmaefveseflgeqdygtsikcfstrvmlhdeepycyISLCFSQLfsakcsevslpqevecvdkk
malaasssssLAAKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESeflgeqdyGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSevslpqevecvdkk
MalaassssslaaKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEvldvpvspllslARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLakffkesseeerehaekfMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVSLPQEVECVDKK
****************AGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFF********************************************ALYAMELALSLEKLTNEKLLSLH************EFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVS***********
**********************************************************PLTGVVFQPFEEVKKEVLDVP**PL**LARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFS******************
************AKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFK**********EKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVSLPQEVECVDKK
*******************************************KRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVSLPQEVECVDK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALAASSSSSLAAKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLHDEEPYCYISLCFSQLFSAKCSEVSLPQEVECVDKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
Q96540254 Ferritin-1, chloroplastic N/A no 0.636 0.688 0.782 2e-79
Q948P6256 Ferritin-3, chloroplastic yes no 0.632 0.679 0.804 2e-78
Q39101255 Ferritin-1, chloroplastic yes no 0.661 0.713 0.721 9e-78
Q94FY2250 Ferritin, chloroplastic O N/A no 0.778 0.856 0.640 2e-77
P19976250 Ferritin-1, chloroplastic no no 0.778 0.856 0.640 2e-77
O65100256 Ferritin-3, chloroplastic N/A no 0.654 0.703 0.744 3e-77
Q8H1T3259 Ferritin-2, chloroplastic N/A no 0.647 0.687 0.752 6e-76
Q41709250 Ferritin-2, chloroplastic N/A no 0.68 0.748 0.743 9e-76
P25699254 Ferritin, chloroplastic O N/A no 0.778 0.842 0.634 3e-75
Q948P5247 Ferritin-4, chloroplastic no no 0.669 0.744 0.743 1e-74
>sp|Q96540|FRI1_BRANA Ferritin-1, chloroplastic OS=Brassica napus GN=LSC30 PE=2 SV=1 Back     alignment and function desciption
 Score =  295 bits (756), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%)

Query: 50  SAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNV 109
           S+ VD N+MP+TGVVFQPFEEVKK  L +P++   SLARQ+Y D  EAAINEQINVEYNV
Sbjct: 48  SSTVDTNNMPMTGVVFQPFEEVKKADLAIPITSNASLARQRYADSSEAAINEQINVEYNV 107

Query: 110 SYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPS 169
           SYVYH++YAYFDRDN+AL+GLAKFFKESS+EEREHAEKFMEYQN RGG+V LH I+ P S
Sbjct: 108 SYVYHSMYAYFDRDNVALKGLAKFFKESSDEEREHAEKFMEYQNQRGGRVTLHPIVSPIS 167

Query: 170 EFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQ 224
           +F+HAEKGDALYAMELALSLEKLTNEKLL+LH VA  NNDPQ+A+FVESEFLGEQ
Sbjct: 168 DFEHAEKGDALYAMELALSLEKLTNEKLLNLHRVASENNDPQLADFVESEFLGEQ 222
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
Brassica napus (taxid: 3708)
EC: 1EC: .EC: 1EC: 6EC: .EC: 3EC: .EC: 1
>sp|Q948P6|FRI3_SOYBN Ferritin-3, chloroplastic OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q39101|FRI1_ARATH Ferritin-1, chloroplastic OS=Arabidopsis thaliana GN=FER1 PE=1 SV=1 Back     alignment and function description
>sp|Q94FY2|FRI_MALXI Ferritin, chloroplastic OS=Malus xiaojinensis PE=3 SV=1 Back     alignment and function description
>sp|P19976|FRI1_SOYBN Ferritin-1, chloroplastic OS=Glycine max PE=1 SV=4 Back     alignment and function description
>sp|O65100|FRI3_VIGUN Ferritin-3, chloroplastic OS=Vigna unguiculata PE=2 SV=1 Back     alignment and function description
>sp|Q8H1T3|FRI2_TOBAC Ferritin-2, chloroplastic OS=Nicotiana tabacum GN=FER2 PE=2 SV=1 Back     alignment and function description
>sp|Q41709|FRI2_VIGUN Ferritin-2, chloroplastic OS=Vigna unguiculata GN=PFE2 PE=2 SV=2 Back     alignment and function description
>sp|P25699|FRI_PHAVU Ferritin, chloroplastic OS=Phaseolus vulgaris GN=PFE PE=2 SV=1 Back     alignment and function description
>sp|Q948P5|FRI4_SOYBN Ferritin-4, chloroplastic OS=Glycine max PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
255571441253 ferritin, plant, putative [Ricinus commu 0.749 0.814 0.671 5e-79
312282781253 unnamed protein product [Thellungiella h 0.687 0.747 0.747 1e-78
396075510254 ferritin 1 [Brassica rapa subsp. pekinen 0.636 0.688 0.788 2e-78
224091042261 predicted protein [Populus trichocarpa] 0.781 0.823 0.691 5e-78
4469288250 ferritin [Medicago sativa] 0.792 0.872 0.656 9e-78
29839389254 RecName: Full=Ferritin-1, chloroplastic; 0.636 0.688 0.782 1e-77
89276793265 iron-binding protein [Pyrus pyrifolia] 0.705 0.732 0.699 1e-77
222160692254 ferritin [Brassica juncea] 0.636 0.688 0.782 3e-77
388507838250 unknown [Medicago truncatula] 0.792 0.872 0.651 5e-77
146160989251 ferritin [Medicago falcata] 0.796 0.872 0.651 5e-77
>gi|255571441|ref|XP_002526668.1| ferritin, plant, putative [Ricinus communis] gi|223533968|gb|EEF35690.1| ferritin, plant, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  300 bits (767), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 173/216 (80%), Gaps = 10/216 (4%)

Query: 19  LITSSSCYTKSTASLVKLGCISP---------RTKRSLK-VSAAVDANSMPLTGVVFQPF 68
           +++S       T  L   G +SP         R +R+   V +A   + + LTGV+FQPF
Sbjct: 1   MLSSGVSAFSVTTRLRSDGVVSPTGNLCSLLQRKRRNTGIVISATAGDGLQLTGVIFQPF 60

Query: 69  EEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALR 128
           EEVKKE   VP++P +SLARQ +EDECEAA+NEQINVEYN SYVYHAL+AYFDRDN+AL+
Sbjct: 61  EEVKKEAFMVPITPQVSLARQLFEDECEAALNEQINVEYNASYVYHALFAYFDRDNVALK 120

Query: 129 GLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALS 188
           GLAKFFKESSEEEREHAEK M+YQN+RGG+VKLH I+ PPSEF+H EKGDALYAMELALS
Sbjct: 121 GLAKFFKESSEEEREHAEKLMQYQNIRGGRVKLHCIVAPPSEFEHVEKGDALYAMELALS 180

Query: 189 LEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQ 224
           LEKLTNEKLL+LHSVAD+NNDPQ+A+F+ESEFL EQ
Sbjct: 181 LEKLTNEKLLNLHSVADKNNDPQLADFIESEFLVEQ 216

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|312282781|dbj|BAJ34256.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|396075510|gb|AFN81242.1| ferritin 1 [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|224091042|ref|XP_002309156.1| predicted protein [Populus trichocarpa] gi|118488573|gb|ABK96099.1| unknown [Populus trichocarpa] gi|222855132|gb|EEE92679.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|4469288|emb|CAA65771.1| ferritin [Medicago sativa] Back     alignment and taxonomy information
>gi|29839389|sp|Q96540.1|FRI1_BRANA RecName: Full=Ferritin-1, chloroplastic; Flags: Precursor gi|1527217|gb|AAB53099.1| ferritin [Brassica napus] Back     alignment and taxonomy information
>gi|89276793|gb|ABD66595.1| iron-binding protein [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|222160692|gb|ACM47495.1| ferritin [Brassica juncea] Back     alignment and taxonomy information
>gi|388507838|gb|AFK41985.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|146160989|gb|ABQ08714.1| ferritin [Medicago falcata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
TAIR|locus:2149755255 FER1 "ferretin 1" [Arabidopsis 0.654 0.705 0.646 6.6e-58
TAIR|locus:2063104259 FER4 "ferritin 4" [Arabidopsis 0.632 0.671 0.632 1.1e-53
TAIR|locus:2074683253 FER2 "ferritin 2" [Arabidopsis 0.669 0.727 0.610 4.9e-53
TAIR|locus:2078481259 FER3 "ferritin 3" [Arabidopsis 0.749 0.795 0.559 6.3e-53
WB|WBGene00001501170 ftn-2 [Caenorhabditis elegans 0.487 0.788 0.442 3.6e-25
UNIPROTKB|Q9TYS3170 ftn-2 "Ferritin" [Caenorhabdit 0.487 0.788 0.442 3.6e-25
UNIPROTKB|F1NL14209 FTH1 "Ferritin" [Gallus gallus 0.483 0.636 0.430 8.7e-24
UNIPROTKB|P08267180 FTH "Ferritin heavy chain" [Ga 0.483 0.738 0.430 8.7e-24
ZFIN|ZDB-GENE-000831-2177 fth1a "ferritin, heavy polypep 0.483 0.751 0.401 1.4e-23
WB|WBGene00001500170 ftn-1 [Caenorhabditis elegans 0.487 0.788 0.405 2.3e-23
TAIR|locus:2149755 FER1 "ferretin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 595 (214.5 bits), Expect = 6.6e-58, P = 6.6e-58
 Identities = 117/181 (64%), Positives = 136/181 (75%)

Query:    45 RSLKVSAA-VDANSMPLTGVVFQPFEEVKKEXXXXXXXXXXXXARQKYEDECEAAINEQI 103
             R++ V+AA VD N+MP+TGVVFQPFEEVKK             ARQ++ D  EA INEQI
Sbjct:    43 RAVVVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQI 102

Query:   104 NVEYNVSYVYHALYAYFDRDNIALRGLXXXXXXXXXXXXXXXXXXMEYQNLRGGKVKLHS 163
             NVEYNVSYVYH++YAYFDRDN+A++GL                  MEYQN RGG+VKLH 
Sbjct:   103 NVEYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKLHP 162

Query:   164 IMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGE 223
             I+ P SEF+HAEKGDALYAMELALSLEKLTNEKLL++H VA  NNDPQ+A+FVESEFLGE
Sbjct:   163 IVSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADFVESEFLGE 222

Query:   224 Q 224
             Q
Sbjct:   223 Q 223
GO:0006826 "iron ion transport" evidence=IEA;IGI;ISS
GO:0006879 "cellular iron ion homeostasis" evidence=IEA;ISS
GO:0008199 "ferric iron binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0046914 "transition metal ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=TAS
GO:0010039 "response to iron ion" evidence=IEP;RCA
GO:0042542 "response to hydrogen peroxide" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009617 "response to bacterium" evidence=IEP;IMP
GO:0016020 "membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0000302 "response to reactive oxygen species" evidence=IGI;RCA
GO:0009908 "flower development" evidence=IGI
GO:0015979 "photosynthesis" evidence=IGI;RCA
GO:0048366 "leaf development" evidence=IGI
GO:0055072 "iron ion homeostasis" evidence=IGI;RCA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005739 "mitochondrion" evidence=IDA
TAIR|locus:2063104 FER4 "ferritin 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074683 FER2 "ferritin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078481 FER3 "ferritin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00001501 ftn-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TYS3 ftn-2 "Ferritin" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL14 FTH1 "Ferritin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P08267 FTH "Ferritin heavy chain" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000831-2 fth1a "ferritin, heavy polypeptide 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00001500 ftn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39101FRI1_ARATH1, ., 1, 6, ., 3, ., 10.72100.66180.7137yesno
Q41709FRI2_VIGUN1, ., 1, 6, ., 3, ., 10.74330.680.748N/Ano
P19975FRI1_PEA1, ., 1, 6, ., 3, ., 10.73250.62540.6798N/Ano
Q948P6FRI3_SOYBN1, ., 1, 6, ., 3, ., 10.80450.63270.6796yesno
O65100FRI3_VIGUN1, ., 1, 6, ., 3, ., 10.74440.65450.7031N/Ano
Q96540FRI1_BRANA1, ., 1, 6, ., 3, ., 10.78280.63630.6889N/Ano
P29390FRI2_MAIZE1, ., 1, 6, ., 3, ., 10.70780.640.6984N/Ano
Q8RX97FRI1_TOBAC1, ., 1, 6, ., 3, ., 10.73860.640.7011N/Ano
Q8H1T3FRI2_TOBAC1, ., 1, 6, ., 3, ., 10.75280.64720.6872N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.16.3.10.946
3rd Layer1.16.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0023033201
RecName- Full=Ferritin; (262 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VI.1271.1
ferrochelatase (EC-4.99.1.1); Catalyzes the ferrous insertion into protoporphyrin IX (By simila [...] (381 aa)
     •• 0.902
eugene3.01350026
ferrochelatase (EC-4.99.1.1); Catalyzes the ferrous insertion into protoporphyrin IX (By simila [...] (506 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
cd01056161 cd01056, Euk_Ferritin, eukaryotic ferritins 4e-63
cd00904160 cd00904, Ferritin, Ferritin iron storage proteins 3e-40
pfam00210142 pfam00210, Ferritin, Ferritin-like domain 2e-31
cd01055156 cd01055, Nonheme_Ferritin, nonheme-containing ferr 5e-25
COG1528167 COG1528, Ftn, Ferritin-like protein [Inorganic ion 9e-17
cd00657130 cd00657, Ferritin_like, Ferritin-like superfamily 1e-05
>gnl|CDD|153114 cd01056, Euk_Ferritin, eukaryotic ferritins Back     alignment and domain information 
 Score =  195 bits (497), Expect = 4e-63
 Identities = 77/132 (58%), Positives = 100/132 (75%), Gaps = 4/132 (3%)

Query: 93  DECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQ 152
           +ECEAA+N+QIN+E N SYVY ++ AYFDRD++AL G AKFF++ S+EEREHAEK ++YQ
Sbjct: 2   EECEAALNKQINLELNASYVYLSMAAYFDRDDVALPGFAKFFRKLSDEEREHAEKLIKYQ 61

Query: 153 NLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQM 212
           N RGG+V L  I +P    +  E G  L A+ELAL LEKL N+ LL LH +A  +NDP +
Sbjct: 62  NKRGGRVVLQDIKKP----EKDEWGSGLEALELALDLEKLVNQSLLDLHKLASEHNDPHL 117

Query: 213 AEFVESEFLGEQ 224
           A+F+ESEFL EQ
Sbjct: 118 ADFLESEFLEEQ 129

Eukaryotic Ferritin (Euk_Ferritin) domain. Ferritins are the primary iron storage proteins of most living organisms and members of a broad superfamily of ferritin-like diiron-carboxylate proteins. The iron-free (apoferritin) ferritin molecule is a protein shell composed of 24 protein chains arranged in 432 symmetry. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the dinuclear ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite; the protein shell can hold up to 4500 iron atoms. In vertebrates, two types of chains (subunits) have been characterized, H or M (fast) and L (slow), which differ in rates of iron uptake and mineralization. Fe(II) oxidation in the H/M subunits take place initially at the ferroxidase center, a carboxylate-bridged diiron center, located within the subunit four-helix bundle. In a complementary role, negatively charged residues on the protein shell inner surface of the L subunits promote ferrihydrite nucleation. Most plant ferritins combine both oxidase and nucleation functions in one chain: they have four interior glutamate residues as well as seven ferroxidase center residues. Length = 161
>gnl|CDD|153098 cd00904, Ferritin, Ferritin iron storage proteins Back     alignment and domain information
>gnl|CDD|215791 pfam00210, Ferritin, Ferritin-like domain Back     alignment and domain information
>gnl|CDD|153113 cd01055, Nonheme_Ferritin, nonheme-containing ferritins Back     alignment and domain information
>gnl|CDD|224445 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|153097 cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
PRK15022167 ferritin-like protein; Provisional 100.0
KOG2332178 consensus Ferritin [Inorganic ion transport and me 100.0
PRK10304165 ferritin; Provisional 100.0
cd00904160 Ferritin Ferritin iron storage proteins. Ferritins 100.0
COG1528167 Ftn Ferritin-like protein [Inorganic ion transport 100.0
cd01056161 Euk_Ferritin eukaryotic ferritins. Eukaryotic Ferr 100.0
cd01055156 Nonheme_Ferritin nonheme-containing ferritins. Non 100.0
PRK10635158 bacterioferritin; Provisional 99.96
TIGR00754157 bfr bacterioferritin. Bacterioferritin is a homomu 99.95
cd00907153 Bacterioferritin Bacterioferritin, ferritin-like d 99.93
PF00210142 Ferritin: Ferritin-like domain; InterPro: IPR00833 99.91
COG2193157 Bfr Bacterioferritin (cytochrome b1) [Inorganic io 99.9
cd01041134 Rubrerythrin Rubrerythrin, ferritin-like diiron-bi 99.87
cd01052148 DPSL DPS-like protein, ferritin-like diiron-bindin 99.85
cd01046123 Rubrerythrin_like rubrerythrin-like, diiron-bindin 99.78
PRK13456186 DNA protection protein DPS; Provisional 99.57
cd01043139 DPS DPS protein, ferritin-like diiron-binding doma 99.29
cd00657130 Ferritin_like Ferritin-like superfamily of diiron- 99.23
cd07908154 Mn_catalase_like Manganese catalase-like protein, 99.22
cd01045139 Ferritin_like_AB Uncharacterized family of ferriti 98.86
cd01051156 Mn_catalase Manganese catalase, ferritin-like diir 98.78
PF02915137 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Ru 98.73
PRK09448162 DNA starvation/stationary phase protection protein 98.41
cd01044125 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin 98.08
COG1633176 Uncharacterized conserved protein [Function unknow 98.01
COG2406172 Protein distantly related to bacterial ferritins [ 97.99
COG0783156 Dps DNA-binding ferritin-like protein (oxidative d 97.86
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.81
PF13668137 Ferritin_2: Ferritin-like domain 97.35
COG1592166 Rubrerythrin [Energy production and conversion] 97.33
cd01042165 DMQH Demethoxyubiquinone hydroxylase, ferritin-lik 96.73
cd01048135 Ferritin_like_AB2 Uncharacterized family of ferrit 96.15
TIGR02284139 conserved hypothetical protein. Members of this pr 95.84
PF09537111 DUF2383: Domain of unknown function (DUF2383); Int 95.43
PF03232172 COQ7: Ubiquinone biosynthesis protein COQ7; InterP 94.98
PF03405330 FA_desaturase_2: Fatty acid desaturase; InterPro: 94.08
cd01050297 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like 93.47
cd01052148 DPSL DPS-like protein, ferritin-like diiron-bindin 92.81
PF04305253 DUF455: Protein of unknown function (DUF455); Inte 92.59
PF05974159 DUF892: Domain of unknown function (DUF892); Inter 92.5
cd00907153 Bacterioferritin Bacterioferritin, ferritin-like d 91.83
PF00210142 Ferritin: Ferritin-like domain; InterPro: IPR00833 90.9
cd07910180 MiaE MiaE tRNA-modifying nonheme diiron monooxygen 89.15
PF12902227 Ferritin-like: Ferritin-like; PDB: 3HL1_A. 87.01
cd01041134 Rubrerythrin Rubrerythrin, ferritin-like diiron-bi 86.62
cd01046123 Rubrerythrin_like rubrerythrin-like, diiron-bindin 86.07
PF02915137 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Ru 86.03
PF09537111 DUF2383: Domain of unknown function (DUF2383); Int 86.0
COG1633176 Uncharacterized conserved protein [Function unknow 85.03
cd01045139 Ferritin_like_AB Uncharacterized family of ferriti 82.46
PF05067283 Mn_catalase: Manganese containing catalase; InterP 80.44
cd07908154 Mn_catalase_like Manganese catalase-like protein, 80.19
>PRK15022 ferritin-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.2e-42  Score=298.48  Aligned_cols=152  Identities=16%  Similarity=0.222  Sum_probs=143.1

Q ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHcCCeeeecccCCCCC
Q 023956           90 KYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPS  169 (275)
Q Consensus        90 ~~s~e~e~aLNeQIn~EL~ASy~YlsmAayFdrd~v~L~GfAkfFr~~S~EEreHAekLikY~n~RGG~V~l~~I~~P~~  169 (275)
                      +.+++++++||+|||.|+++||+|++||+||+  +.+|||||+||+.+|.|||+||+||++|+++|||+|.+++|++|..
T Consensus         1 m~~~~~~~~LN~QIn~E~~aSy~YLsMa~~~~--~~~L~GfA~ff~~qa~EEreHA~k~~~yl~~rGg~v~l~~I~~P~~   78 (167)
T PRK15022          1 MATAGMLLKLNSQMNLEFYASNLYLHLSEWCS--EQSLNGTATFLRAQAQSNVTQMMRMFNFMKSAGATPIVKAIDVPGE   78 (167)
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--hCCChhHHHHHHHHHHHHHHHHHHHHHHHHHcCCceeeCCCCCCcc
Confidence            35789999999999999999999999999998  6699999999999999999999999999999999999999999976


Q ss_pred             CCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCChhHHHHhHHHhhhchhhhh-HHHHHHHHHHHcCCCCcchH
Q 023956          170 EFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGT-SIKCFSTRVMLHDEEPYCYI  248 (275)
Q Consensus       170 ef~~~e~g~~l~ale~AL~lEk~vt~~L~eL~~vA~~~~D~~t~dFLE~~FL~EQVEEe-~Ik~l~d~l~~lg~~~~~y~  248 (275)
                      +     |++++++|+.+|++|+.||+.|++|+++|.+.+|++|++||+ ||+.||+||+ .+++|.++++.+|+.|.|.+
T Consensus        79 ~-----~~s~~e~fe~al~hEk~vt~~I~~L~~~A~~~~D~~t~~FL~-wfv~EQ~eEe~~~~~ild~l~~~~~~g~g~~  152 (167)
T PRK15022         79 K-----LNSLEELFQKTLEEYEQRSSTLAQLADEAKALNDDSTLNFLR-DLEKEQQHDGLLLQTILDEVRSAKLAGLCPV  152 (167)
T ss_pred             c-----cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHhHHHHHH-HHHHHHHHHHHHHHHHHHHHHhcCCCCcchh
Confidence            5     568999999999999999999999999999999999999999 9999999777 69999999999998877665


Q ss_pred             H
Q 023956          249 S  249 (275)
Q Consensus       249 ~  249 (275)
                      .
T Consensus       153 ~  153 (167)
T PRK15022        153 Q  153 (167)
T ss_pred             H
Confidence            3

>KOG2332 consensus Ferritin [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10304 ferritin; Provisional Back     alignment and domain information
>cd00904 Ferritin Ferritin iron storage proteins Back     alignment and domain information
>COG1528 Ftn Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01056 Euk_Ferritin eukaryotic ferritins Back     alignment and domain information
>cd01055 Nonheme_Ferritin nonheme-containing ferritins Back     alignment and domain information
>PRK10635 bacterioferritin; Provisional Back     alignment and domain information
>TIGR00754 bfr bacterioferritin Back     alignment and domain information
>cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain Back     alignment and domain information
>PF00210 Ferritin: Ferritin-like domain; InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms [] Back     alignment and domain information
>COG2193 Bfr Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain Back     alignment and domain information
>PRK13456 DNA protection protein DPS; Provisional Back     alignment and domain information
>cd01043 DPS DPS protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>cd01051 Mn_catalase Manganese catalase, ferritin-like diiron-binding domain Back     alignment and domain information
>PF02915 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Rubrerythrin (Rr), found in anaerobic sulphate-reducing bacteria [], is a fusion protein containing an N-terminal diiron-binding domain and a C-terminal domain homologous to rubredoxin [] Back     alignment and domain information
>PRK09448 DNA starvation/stationary phase protection protein Dps; Provisional Back     alignment and domain information
>cd01044 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2406 Protein distantly related to bacterial ferritins [General function prediction only] Back     alignment and domain information
>COG0783 Dps DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PF13668 Ferritin_2: Ferritin-like domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01048 Ferritin_like_AB2 Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>TIGR02284 conserved hypothetical protein Back     alignment and domain information
>PF09537 DUF2383: Domain of unknown function (DUF2383); InterPro: IPR019052 This entry represents a functionally uncharacterised ferritin like domain Back     alignment and domain information
>PF03232 COQ7: Ubiquinone biosynthesis protein COQ7; InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ] Back     alignment and domain information
>PF03405 FA_desaturase_2: Fatty acid desaturase; InterPro: IPR005067 Fatty acid desaturases are enzymes that catalyze the insertion of a double bond at the delta position of fatty acids Back     alignment and domain information
>cd01050 Acyl_ACP_Desat Acyl ACP desaturase, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PF04305 DUF455: Protein of unknown function (DUF455); InterPro: IPR007402 This is a family of uncharacterised proteins Back     alignment and domain information
>PF05974 DUF892: Domain of unknown function (DUF892); InterPro: IPR010287 This domain is found in several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain Back     alignment and domain information
>PF00210 Ferritin: Ferritin-like domain; InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms [] Back     alignment and domain information
>cd07910 MiaE MiaE tRNA-modifying nonheme diiron monooxygenase, ferritin-like diiron-binding domain Back     alignment and domain information
>PF12902 Ferritin-like: Ferritin-like; PDB: 3HL1_A Back     alignment and domain information
>cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain Back     alignment and domain information
>PF02915 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Rubrerythrin (Rr), found in anaerobic sulphate-reducing bacteria [], is a fusion protein containing an N-terminal diiron-binding domain and a C-terminal domain homologous to rubredoxin [] Back     alignment and domain information
>PF09537 DUF2383: Domain of unknown function (DUF2383); InterPro: IPR019052 This entry represents a functionally uncharacterised ferritin like domain Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>PF05067 Mn_catalase: Manganese containing catalase; InterPro: IPR007760 Catalases (1 Back     alignment and domain information
>cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
3a68_A212 Crystal Structure Of Plant Ferritin Reveals A Novel 2e-59
3a9q_A212 Crystal Structure Analysis Of E173a Variant Of The 1e-58
3vnx_A204 Crystal Structure Of Ferritin From Multicellular Gr 2e-37
1mfr_A176 Crystal Structure Of M Ferritin Length = 176 6e-25
3ka8_A176 Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 1 7e-25
3ka6_A176 Frog M-Ferritin, Eed Mutant, With Cobalt Length = 1 2e-24
3ka9_A176 Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 1 2e-24
3se1_A176 Frog M-Ferritin With Magnesium, R72d Mutant Length 5e-24
3sh6_A176 Frog M-Ferritin, D122r Mutant, With Magnesium Lengt 5e-24
3shx_A176 Frog M-Ferritin With Magnesium, L134p Mutant Length 5e-24
4dyx_A172 Crystal Structure Of The Cu-adduct Of Human H-ferri 2e-23
3es3_A183 Directing Noble Metal Ion Chemistry Within A Design 4e-23
2cei_A183 Recombinant Human H Ferritin, K86q Mutant, Soaked W 8e-23
3erz_A183 Directing Noble Metal Ion Chemistry Within A Design 8e-23
2z6m_A176 Crystal Structure Of Human Ferritin H8 As Biotempla 8e-23
3ajo_A182 Crystal Structure Of Wild-Type Human Ferritin H Cha 1e-22
2chi_A183 Recombinant Human H Ferritin, K86q And E27d Mutant 2e-22
2clu_A183 Recombinant Human H Ferritin, K86q And E107d Mutant 2e-22
3ajq_A182 Crystal Structure Of Human H Ferritin E140q Mutant 2e-22
2cn7_A183 Recombinant Human H Ferritin, K86q, E27d And E107d 4e-22
3ajp_A182 Crystal Structure Of Human H Ferritin E140a Mutant 5e-22
1rcc_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 5e-22
4dyy_A172 Crystal Structure Of The Cu-adduct Of Human H-ferri 8e-22
1rcd_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 1e-21
4dz0_A172 Crystal Structure Of The Cu-adduct Of Human H-ferri 2e-21
1rci_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 3e-21
1bg7_A176 Localized Unfolding At The Junction Of Three Ferrit 4e-21
1r03_A182 Crystal Structure Of A Human Mitochondrial Ferritin 5e-21
3af8_X174 Crystal Structure Of Pd(Ally)APO-C126afr Length = 1 5e-19
3af9_X174 Crystal Structure Of Pd(Allyl)APO-C48afr Length = 1 1e-18
1h96_A182 Recombinant Mouse L-Chain Ferritin Length = 182 1e-18
2zur_X174 Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 2e-18
1ies_A174 Tetragonal Crystal Structure Of Native Horse Spleen 2e-18
2gyd_A170 Complex Of Equine Apoferritin With The H-Diaziflura 2e-18
3np2_X174 Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Le 3e-18
3np0_X174 Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlf 4e-18
3noz_X174 Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Le 5e-18
3kxu_A191 Crystal Structure Of Human Ferritin Ftl498instc Pat 6e-18
3hx2_A192 Crystal Structure Of Human Ferritin Phe167serfsx26 6e-18
2v2p_A174 Mutant (E53,56,57,60q And R59m) Recombinant Horse S 9e-18
2v2l_A174 Mutant (E53,56,57,60q) Recombinant Horse Spleen Apo 9e-18
2fg4_A174 Structure Of Human Ferritin L Chain Length = 174 1e-17
2ffx_J173 Structure Of Human Ferritin L. Chain Length = 173 1e-17
2zg8_X174 Crystal Structure Of Pd(Allyl)APO-H49afr Length = 1 1e-17
2v2n_A174 Mutant R59m Recombinant Horse Spleen Apoferritin Co 2e-17
2za6_A175 Recombinant Horse L-Chain Apoferritin Length = 175 2e-17
2g4h_A174 Anomalous Substructure Of Apoferritin Length = 174 2e-17
2za7_A171 Recombinant Horse L-Chain Apoferritin N-Terminal De 2e-17
2zg9_X174 Crystal Structure Of Pd(Allyl)APO-H114afr Length = 2e-16
2za8_A167 Recombinant Horse L-Chain Apoferritin N-Terminal De 3e-16
3kx9_A173 Engineering A Closed Form Of The Archaeoglobus Fulg 2e-07
1s3q_A173 Crystal Structures Of A Novel Open Pore Ferritin Fr 7e-07
1z4a_A164 Ferritin From T. Maritima Length = 164 4e-06
2x17_0173 The X-Ray Structure Of Ferritin From Pyrococcus Fur 6e-06
2jd6_0174 Crystal Structure Of The As Isolated Ferritin From 6e-06
1vlg_A176 Crystal Structure Of Ferritin (Tm1128) From Thermot 1e-05
>pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal Binding Site That Functions As A Transit Site For Metal Transfer In Ferritin Length = 212 Back     alignment and structure 
Iteration: 1

 Score =  225 bits (573), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 127/169 (75%)
Query: 56  NSMPLTGVVFQPFEEVKKEXXXXXXXXXXXXARQKYEDECEAAINEQINVEYNVSYVYHA 115
           N   LTGV+F+PFEEVKKE            ARQKY DE E+A+NEQINVEYNVSYVYHA
Sbjct: 6   NHRALTGVIFEPFEEVKKELDLVPTVPQASLARQKYVDESESAVNEQINVEYNVSYVYHA 65
Query: 116 LYAYFDRDNIALRGLXXXXXXXXXXXXXXXXXXMEYQNLRGGKVKLHSIMQPPSEFDHAE 175
           ++AYFDRDN+ALRGL                  MEYQN RGGKVKL SI+ P S+FDHA+
Sbjct: 66  MFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSDFDHAD 125
Query: 176 KGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQ 224
           KGDAL+AMELALSLEKLTNEKLL+LHSVA +N D Q+A+FVE+E+LGEQ
Sbjct: 126 KGDALHAMELALSLEKLTNEKLLNLHSVATKNGDVQLADFVETEYLGEQ 174
>pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean Ferritin Sfer4 Length = 212 Back     alignment and structure
>pdb|3VNX|A Chain A, Crystal Structure Of Ferritin From Multicellular Green Algae, Ulva Pertusa Length = 204 Back     alignment and structure
>pdb|1MFR|A Chain A, Crystal Structure Of M Ferritin Length = 176 Back     alignment and structure
>pdb|3KA8|A Chain A, Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 176 Back     alignment and structure
>pdb|3KA6|A Chain A, Frog M-Ferritin, Eed Mutant, With Cobalt Length = 176 Back     alignment and structure
>pdb|3KA9|A Chain A, Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 176 Back     alignment and structure
>pdb|3SE1|A Chain A, Frog M-Ferritin With Magnesium, R72d Mutant Length = 176 Back     alignment and structure
>pdb|3SH6|A Chain A, Frog M-Ferritin, D122r Mutant, With Magnesium Length = 176 Back     alignment and structure
>pdb|3SHX|A Chain A, Frog M-Ferritin With Magnesium, L134p Mutant Length = 176 Back     alignment and structure
>pdb|4DYX|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant 4his- Delta C-star Length = 172 Back     alignment and structure
>pdb|3ES3|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. The Complex With Gold Ions. Ferritin H8-H9x Mutant Length = 183 Back     alignment and structure
>pdb|2CEI|A Chain A, Recombinant Human H Ferritin, K86q Mutant, Soaked With Zn Length = 183 Back     alignment and structure
>pdb|3ERZ|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. Mercury Ions On The Three-Fold Channel Length = 183 Back     alignment and structure
>pdb|2Z6M|A Chain A, Crystal Structure Of Human Ferritin H8 As Biotemplate For Noble Metal Nanoparticle Synthesis Length = 176 Back     alignment and structure
>pdb|3AJO|A Chain A, Crystal Structure Of Wild-Type Human Ferritin H Chain Length = 182 Back     alignment and structure
>pdb|2CHI|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant Length = 183 Back     alignment and structure
>pdb|2CLU|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant Length = 183 Back     alignment and structure
>pdb|3AJQ|A Chain A, Crystal Structure Of Human H Ferritin E140q Mutant Length = 182 Back     alignment and structure
>pdb|2CN7|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d Mutant Length = 183 Back     alignment and structure
>pdb|3AJP|A Chain A, Crystal Structure Of Human H Ferritin E140a Mutant Length = 182 Back     alignment and structure
>pdb|1RCC|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>pdb|4DYY|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant Mic1 Length = 172 Back     alignment and structure
>pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>pdb|4DZ0|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant Mic1 Labeled With A Dansyl Fluorophore Length = 172 Back     alignment and structure
>pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>pdb|1BG7|A Chain A, Localized Unfolding At The Junction Of Three Ferritin Subunits. A Mechanism For Iron Release? Length = 176 Back     alignment and structure
>pdb|1R03|A Chain A, Crystal Structure Of A Human Mitochondrial Ferritin Length = 182 Back     alignment and structure
>pdb|3AF8|X Chain X, Crystal Structure Of Pd(Ally)APO-C126afr Length = 174 Back     alignment and structure
>pdb|3AF9|X Chain X, Crystal Structure Of Pd(Allyl)APO-C48afr Length = 174 Back     alignment and structure
>pdb|1H96|A Chain A, Recombinant Mouse L-Chain Ferritin Length = 182 Back     alignment and structure
>pdb|2ZUR|X Chain X, Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 Back     alignment and structure
>pdb|1IES|A Chain A, Tetragonal Crystal Structure Of Native Horse Spleen Ferritin Length = 174 Back     alignment and structure
>pdb|2GYD|A Chain A, Complex Of Equine Apoferritin With The H-Diaziflurane Photolabeling Reagent Length = 170 Back     alignment and structure
>pdb|3NP2|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Length = 174 Back     alignment and structure
>pdb|3NP0|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlfr Length = 174 Back     alignment and structure
>pdb|3NOZ|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Length = 174 Back     alignment and structure
>pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc Pathogenic M Length = 191 Back     alignment and structure
>pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of The Biological Unit That Are Present In The Crystallographic Asymmetric Unit. The Entire Structure Contains Six Copies Of The Biological Unit In The Crystallographic Asymmetric Unit And Is Described In Remark 400 Length = 192 Back     alignment and structure
>pdb|2V2P|A Chain A, Mutant (E53,56,57,60q And R59m) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>pdb|2V2L|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain Length = 174 Back     alignment and structure
>pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain Length = 173 Back     alignment and structure
>pdb|2ZG8|X Chain X, Crystal Structure Of Pd(Allyl)APO-H49afr Length = 174 Back     alignment and structure
>pdb|2V2N|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 Back     alignment and structure
>pdb|2ZA6|A Chain A, Recombinant Horse L-Chain Apoferritin Length = 175 Back     alignment and structure
>pdb|2G4H|A Chain A, Anomalous Substructure Of Apoferritin Length = 174 Back     alignment and structure
>pdb|2ZA7|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-4) Length = 171 Back     alignment and structure
>pdb|2ZG9|X Chain X, Crystal Structure Of Pd(Allyl)APO-H114afr Length = 174 Back     alignment and structure
>pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-8) Length = 167 Back     alignment and structure
>pdb|3KX9|A Chain A, Engineering A Closed Form Of The Archaeoglobus Fulgidus Ferritin By Site Directed Mutagenesis Length = 173 Back     alignment and structure
>pdb|1S3Q|A Chain A, Crystal Structures Of A Novel Open Pore Ferritin From The Hyperthermophilic Archaeon Archaeoglobus Fulgidus Length = 173 Back     alignment and structure
>pdb|1Z4A|A Chain A, Ferritin From T. Maritima Length = 164 Back     alignment and structure
>pdb|2X17|0 Chain 0, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus Loaded With Ag(I) Length = 173 Back     alignment and structure
>pdb|2JD6|0 Chain 0, Crystal Structure Of The As Isolated Ferritin From The Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus Length = 174 Back     alignment and structure
>pdb|1VLG|A Chain A, Crystal Structure Of Ferritin (Tm1128) From Thermotoga Maritima At 2.00 A Resolution Length = 176 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle 3e-80
3vnx_A204 Ferritin; 4-helix bundle, iron storage, oxidoreduc 2e-77
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI 7e-61
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} 6e-60
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, ir 5e-59
1z6o_M191 Ferritin heavy chain; metal binding protein, iron 8e-57
2v2p_A174 Ferritin light chain; metal transport, iron, haemi 3e-56
3kxu_A191 Ferritin; iron storage protein, disorder, iron, me 8e-56
3oj5_A189 Ferritin family protein; ferroxidase, cytosol, oxi 4e-55
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductas 1e-54
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, prote 2e-54
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, 6e-53
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron sto 1e-52
1krq_A167 Ferritin; H-chain like four-helix bundle, binding 4e-52
3qz3_A184 Ferritin; structural genomics, the center for stru 9e-52
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A { 2e-51
3bvf_A181 Ferritin; iron storage, metal-binding, oxidoreduct 5e-50
1z6o_A212 Ferritin light chain; metal binding protein, iron 3e-46
3qb9_A174 Bacterioferritin, BFR; cytosol, structural genomic 4e-10
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal 8e-10
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron T 9e-10
3r2k_A154 Bacterioferritin, BFR; bacterial ferritin, iron bi 1e-09
2y3q_A158 Bacterioferritin; metal binding protein, redox; HE 1e-08
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structura 6e-08
1nfv_A179 Bacterioferritin; 24 subunits in the active molecu 5e-06
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Length = 212 Back     alignment and structure
 Score =  240 bits (614), Expect = 3e-80
 Identities = 133/174 (76%), Positives = 151/174 (86%)

Query: 51  AAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVS 110
           A    N   LTGV+F+PFEEVKKE+  VP  P  SLARQKY DE E+A+NEQINVEYNVS
Sbjct: 1   AKGSTNHRALTGVIFEPFEEVKKELDLVPTVPQASLARQKYVDESESAVNEQINVEYNVS 60

Query: 111 YVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSE 170
           YVYHA++AYFDRDN+ALRGLAKFFKESSEEEREHAEK MEYQN RGGKVKL SI+ P S+
Sbjct: 61  YVYHAMFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSD 120

Query: 171 FDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQ 224
           FDHA+KGDAL+AMELALSLEKLTNEKLL+LHSVA +N D Q+A+FVE+E+LGEQ
Sbjct: 121 FDHADKGDALHAMELALSLEKLTNEKLLNLHSVATKNGDVQLADFVETEYLGEQ 174
>3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Length = 204 Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Length = 183 Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Length = 173 Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Length = 176 Back     alignment and structure
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 191 Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Length = 174 Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Length = 191 Back     alignment and structure
>3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Length = 189 Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} PDB: 3e6r_A Length = 168 Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Length = 176 Back     alignment and structure
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Length = 174 Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Length = 173 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Length = 167 Back     alignment and structure
>3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} Length = 184 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Length = 165 Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 212 Back     alignment and structure
>3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Length = 174 Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Length = 161 Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Length = 155 Back     alignment and structure
>3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Length = 154 Back     alignment and structure
>2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Length = 158 Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Length = 182 Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Length = 179 Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} Length = 161 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
3vnx_A204 Ferritin; 4-helix bundle, iron storage, oxidoreduc 100.0
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle 100.0
3kxu_A191 Ferritin; iron storage protein, disorder, iron, me 100.0
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, ir 100.0
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI 100.0
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} 100.0
2v2p_A174 Ferritin light chain; metal transport, iron, haemi 100.0
1z6o_A212 Ferritin light chain; metal binding protein, iron 100.0
1z6o_M191 Ferritin heavy chain; metal binding protein, iron 100.0
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductas 100.0
3uno_A189 Probable bacterioferritin BFRB; ferroxidase activi 100.0
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron sto 100.0
3qz3_A184 Ferritin; structural genomics, the center for stru 100.0
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A { 100.0
1krq_A167 Ferritin; H-chain like four-helix bundle, binding 100.0
3bvf_A181 Ferritin; iron storage, metal-binding, oxidoreduct 100.0
4am5_A159 Bacterioferritin; metal binding protein, ferroxida 100.0
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, prote 100.0
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, 99.97
3oj5_A189 Ferritin family protein; ferroxidase, cytosol, oxi 99.96
3uoi_A161 Bacterioferritin, BFR; structural genomics, TB str 99.95
3r2k_A154 Bacterioferritin, BFR; bacterial ferritin, iron bi 99.95
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida 99.94
2y3q_A158 Bacterioferritin; metal binding protein, redox; HE 99.94
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structura 99.94
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron T 99.94
3qb9_A174 Bacterioferritin, BFR; cytosol, structural genomic 99.94
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal 99.93
1nfv_A179 Bacterioferritin; 24 subunits in the active molecu 99.93
2vzb_A170 Putative bacterioferritin-related protein; DPS, DP 99.91
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 99.91
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferriti 99.9
1ji5_A142 DLP-1; dodecamer, four-helix bundle, metal transpo 99.89
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, 99.89
2c41_A158 DPS family DNA-binding stress response protein; ir 99.88
1n1q_A149 DPS protein; four-helix bundle, unknown function; 99.87
1jig_A146 DLP-2; dodecamer, four-helix bundle, metal transpo 99.86
2vxx_A192 Starvation induced DNA binding protein; stress res 99.86
2d5k_A156 DPS, DPS family protein; four helix bundle, metal 99.85
2clb_A188 DPS-like protein; DI-iron carboxylate, hypothetica 99.84
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 99.78
1tjo_A182 Iron-rich DPSA-homolog protein; ferritin, low-iron 99.74
2fjc_A156 Antigen TPF1; mini ferritin, iron binding protein, 99.54
2chp_A153 MRGA, metalloregulation DNA-binding stress protein 99.53
1o9r_A162 Agrobacterium tumefaciens DPS; iron-binding protei 99.52
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 99.52
2yjk_A161 AFP, DPS; metal-binding protein, iron uptake, ferr 99.52
2bk6_A156 Non-heme iron-containing ferritin; DPS (DNA bindin 99.52
2c2u_A207 DPS, DNA-binding stress response protein; DNA-bind 99.49
2yw6_A183 DNA protection during starvation protein; DNA-bind 99.46
2z90_A161 Starvation-inducible DNA-binding protein or FINE t 99.46
2cf7_A165 DPR; peroxide resistance, DPS-family, ferritin-lik 99.45
2wlu_A175 DPS-like peroxide resistance protein; DNA-binding, 99.45
2c2j_A211 DNA-binding stress response protein; DNA-binding p 99.45
2xgw_A199 Peroxide resistance protein; metal binding protein 99.44
3ak8_A167 DNA protection during starvation protein; DPS-like 99.4
4di0_A144 Rubrerythrin; ssgcid, seattle structural genomics 99.39
3kwo_A152 Putative bacterioferritin; alpha-helix, bacterial 99.38
3iq1_A159 DPS family protein; csgid, SAD, niaid, metal trans 99.37
4eve_A164 Neutrophil-activating protein; dodecamer, four-hel 99.35
2pyb_A151 NAPA, neutrophil activating protein; ferritin, DPS 99.33
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved p 99.16
2fzf_A175 Hypothetical protein; structural genomics, southea 98.94
4a25_A169 DPS, ferritin DPS family protein; metal binding pr 98.67
3qhb_A179 Symerythrin, ORF180; four-helix bundle, carboxylat 98.42
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein; 98.31
4etr_A153 Putative uncharacterized protein; DUF2383, domain 98.22
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 97.9
1zuj_A179 Hypothetical protein llacc01001955; oxidative stre 97.83
1zs3_A182 Lactococcus lactis Mg1363 DPSA; oxidative stress, 97.82
1o9i_A266 Pseudocatalase; oxidoreductase, hexamer, dimangane 97.57
2v8t_A302 Manganese-containing pseudocatalase; manganese cat 97.49
3k6c_A95 Uncharacterized protein NE0167; structural genomic 95.32
2ib0_A170 Conserved hypothetical alanine rich protein; 4-hel 95.18
1zpy_A95 Hypothetical protein NE0167; structural genomics, 95.13
2gs4_A166 Protein YCIF; stress proteins, rubrerythrin, metal 94.71
2gyq_A173 YCFI, putative structural protein; structural geno 94.24
1jm0_A50 Protein (four-helix bundle model); alpha-helical b 93.67
2uw1_A338 Desaturase, plastid delta4 multifunctional acyl-AC 93.55
3ogh_B171 Protein YCIE; iron-binding, MCSG, four-helix-bundl 93.41
3q4o_A196 Uncharacterized protein MJ0754; ferritin-like prot 92.6
1za0_A275 Possible acyl-[acyl-carrier protein] desaturase D 92.47
3hl1_A 317 Ferritin like protein; structural genomics, joint 92.27
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein; 91.8
2y3q_A158 Bacterioferritin; metal binding protein, redox; HE 90.4
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal 90.33
4di0_A144 Rubrerythrin; ssgcid, seattle structural genomics 90.29
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, 90.2
2fzf_A175 Hypothetical protein; structural genomics, southea 90.18
3hiu_A166 Uncharacterized protein; APC40011, XCC3681, xantho 90.13
1nfv_A179 Bacterioferritin; 24 subunits in the active molecu 89.87
2itb_A206 TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative 89.73
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron T 89.59
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferriti 89.28
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida 88.18
3r2k_A154 Bacterioferritin, BFR; bacterial ferritin, iron bi 87.9
3uoi_A161 Bacterioferritin, BFR; structural genomics, TB str 87.23
3qb9_A174 Bacterioferritin, BFR; cytosol, structural genomic 87.12
2e0z_A 345 Virus-like particle; bacteriophage, HK97; 3.60A {P 86.8
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved p 86.68
4am5_A159 Bacterioferritin; metal binding protein, ferroxida 86.61
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 85.96
2vzb_A170 Putative bacterioferritin-related protein; DPS, DP 85.76
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structura 84.46
2c41_A158 DPS family DNA-binding stress response protein; ir 84.43
2vxx_A192 Starvation induced DNA binding protein; stress res 83.82
3qhb_A179 Symerythrin, ORF180; four-helix bundle, carboxylat 82.87
4etr_A153 Putative uncharacterized protein; DUF2383, domain 80.56
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 80.26
>3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Back     alignment and structure
Probab=100.00  E-value=2.8e-56  Score=394.97  Aligned_cols=183  Identities=53%  Similarity=0.838  Sum_probs=171.2

Q ss_pred             CccccccccchHhhhhhhhcCCCCC-cchhhhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCccchhHHHHHHH
Q 023956           58 MPLTGVVFQPFEEVKKEVLDVPVSP-LLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKE  136 (275)
Q Consensus        58 ~~~~~~~~~p~~e~~~~~~~~~~~~-~~s~aRq~~s~e~e~aLNeQIn~EL~ASy~YlsmAayFdrd~v~L~GfAkfFr~  136 (275)
                      +++|||||+||+|||+++.+||++| +.|++||+|+++|+++||+|||.||+|||+|++||+||++++|||+||++||++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~rq~~~~~v~~~LN~qin~EL~As~~Ylsma~~f~~~d~~l~g~a~~f~~   81 (204)
T 3vnx_A            2 QEVTGMVFQPFSEVQGELSTVTQAPVTDSYARVEYHIECEAAINEQINIEYTISYVYHALHSYFARDNVGLPGFAKFFKE   81 (204)
T ss_dssp             ------CCCHHHHTHHHHHHHHHCCTTSCSSCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTTCCHHHHHHHHH
T ss_pred             CCCCcceeccHHHHHHHHhcCCCCCCccccceecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHH
Confidence            5799999999999999999999998 679999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHcCCeeeecccCCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCChhHHHHh
Q 023956          137 SSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFV  216 (275)
Q Consensus       137 ~S~EEreHAekLikY~n~RGG~V~l~~I~~P~~ef~~~e~g~~l~ale~AL~lEk~vt~~L~eL~~vA~~~~D~~t~dFL  216 (275)
                      +|+|||+||++|++||++|||+|.+++|.+|..+|++.+|++++++|+.+|++|+.+++.|++||++|.+.+|+++++||
T Consensus        82 ~s~EE~~HA~kLi~yi~~rGG~~~l~~i~~p~~~~~~~~~~~~~e~le~aL~~Ek~v~~~l~~l~~lA~~~~D~~t~~fL  161 (204)
T 3vnx_A           82 ASDEEREHAHMLMDYQTKRGGRVELKPLAAPEMEFANDDKGEALYAMELALSLEKLNFQKLQALQAIADKHKDAALCDFV  161 (204)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCCCCCTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCcccCCCCCCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCChHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhchhhhhHHHHHHHHHHHcCC
Q 023956          217 ESEFLGEQDYGTSIKCFSTRVMLHDE  242 (275)
Q Consensus       217 E~~FL~EQVEEe~Ik~l~d~l~~lg~  242 (275)
                      ++|||+||+  ++|+++.++++++..
T Consensus       162 e~~fL~EQv--e~i~~l~~~l~~l~~  185 (204)
T 3vnx_A          162 EGGLLSEQV--DAVKEHAVYVSQLRR  185 (204)
T ss_dssp             HHTHHHHHH--HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHH--HHHHHHHHHHHHHHH
Confidence            999999999  888888888776644
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 4das_A* 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} SCOP: a.25.1.1 PDB: 3e6r_A Back     alignment and structure
>3uno_A Probable bacterioferritin BFRB; ferroxidase activity, iron storage, oxidoreductase; 2.50A {Mycobacterium tuberculosis} PDB: 3oj5_A 3qd8_A Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Back     alignment and structure
>3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: a.25.1.1 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Back     alignment and structure
>4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Back     alignment and structure
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Back     alignment and structure
>3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Back     alignment and structure
>3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* Back     alignment and structure
>3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} SCOP: a.25.1.1 Back     alignment and structure
>2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Back     alignment and structure
>3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
>1ji5_A DLP-1; dodecamer, four-helix bundle, metal transport; 2.50A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 Back     alignment and structure
>2c41_A DPS family DNA-binding stress response protein; iron-binding/oxidation protein, DPS (DNA-binding proteins from starved cells); HET: PG4 PGE; 1.81A {Thermosynechococcus elongatus} Back     alignment and structure
>1n1q_A DPS protein; four-helix bundle, unknown function; 2.20A {Brevibacillus brevis} SCOP: a.25.1.1 Back     alignment and structure
>1jig_A DLP-2; dodecamer, four-helix bundle, metal transport; 1.46A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>2vxx_A Starvation induced DNA binding protein; stress response protein, DPS, oxidation, iron binding, ferroxidase centre; HET: PG4; 2.40A {Synechococcus elongatus} Back     alignment and structure
>2d5k_A DPS, DPS family protein; four helix bundle, metal binding protein; 1.85A {Staphylococcus aureus subsp} Back     alignment and structure
>2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1tjo_A Iron-rich DPSA-homolog protein; ferritin, low-iron, metal binding protein; 1.60A {Halobacterium salinarum} SCOP: a.25.1.1 PDB: 1moj_A 1tk6_A 1tko_A 1tkp_A Back     alignment and structure
>2fjc_A Antigen TPF1; mini ferritin, iron binding protein, metal transport; 2.50A {Treponema pallidum} SCOP: a.25.1.1 Back     alignment and structure
>2chp_A MRGA, metalloregulation DNA-binding stress protein; DNA-binding protein, DPS, dodecameric, ferritin; 2.0A {Bacillus subtilis} Back     alignment and structure
>1o9r_A Agrobacterium tumefaciens DPS; iron-binding protein, DNA protection from oxidative damage, DNA-binding, iron- binding protein; 1.45A {Agrobacterium tumefaciens} SCOP: a.25.1.1 PDB: 3ge4_A* Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2yjk_A AFP, DPS; metal-binding protein, iron uptake, ferritin fold; 2.00A {Microbacterium arborescens} PDB: 2yjj_A Back     alignment and structure
>2bk6_A Non-heme iron-containing ferritin; DPS (DNA binding protein from starved cells), ferroxidase center, mutagenesis study; 2.19A {Listeria innocua} SCOP: a.25.1.1 PDB: 1qgh_A 2bjy_A 2iy4_A 2bkc_A Back     alignment and structure
>2c2u_A DPS, DNA-binding stress response protein; DNA-binding protein, iron; 1.1A {Deinococcus radiodurans} PDB: 2c2f_A 2f7n_A Back     alignment and structure
>2yw6_A DNA protection during starvation protein; DNA-binding protein, quarternary assembly, ferroxidation, oxidoreductase; HET: DNA; 2.53A {Mycobacterium smegmatis} SCOP: a.25.1.1 PDB: 1vei_A 1vel_A 1veq_A 1uvh_A* 2yw7_A Back     alignment and structure
>2z90_A Starvation-inducible DNA-binding protein or FINE tangled PILI major subunit; quarternary assembly, ferroxidation; 2.40A {Mycobacterium smegmatis str} Back     alignment and structure
>2cf7_A DPR; peroxide resistance, DPS-family, ferritin-like, ferroxidase, iron-binding; HET: EPE; 1.50A {Streptococcus suis} PDB: 2ux1_A* 2bw1_A* 1umn_A* 2v15_A* 2xjm_A* 2xjn_A* 2xjo_A* 2xkq_A* Back     alignment and structure
>2wlu_A DPS-like peroxide resistance protein; DNA-binding, oxidoreductase; 1.94A {Streptococcus pyogenes} PDB: 2wla_A Back     alignment and structure
>2c2j_A DNA-binding stress response protein; DNA-binding protein, DPS; 2.05A {Deinococcus radiodurans} PDB: 2c6r_A Back     alignment and structure
>2xgw_A Peroxide resistance protein; metal binding protein; 2.10A {Streptococcus pyogenes} Back     alignment and structure
>3ak8_A DNA protection during starvation protein; DPS-like protein, dodecamer, iron-binding protein, metal BIN protein, oxidoreductase; HET: DNA; 1.25A {Salmonella enterica subsp} PDB: 3ak9_A* 1f33_A* 1f30_A* 1dps_A 1jts_A* 1jre_A* 1l8h_A* 1l8i_A* 4dyu_A* Back     alignment and structure
>4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} Back     alignment and structure
>3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} SCOP: a.25.1.0 Back     alignment and structure
>3iq1_A DPS family protein; csgid, SAD, niaid, metal transport, STRU genomics, center for structural genomics of infectious DISE; 1.67A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4eve_A Neutrophil-activating protein; dodecamer, four-helix bundle, metal transport; 2.10A {Helicobacter pylori} PDB: 4evd_A 3t9j_A 3ta8_A 4evb_A 4evc_A 1ji4_A Back     alignment and structure
>2pyb_A NAPA, neutrophil activating protein; ferritin, DPS, four-helix bundle, metal transport; 2.60A {Borrelia burgdorferi} Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>4a25_A DPS, ferritin DPS family protein; metal binding protein, detoxification process; 2.00A {Kineococcus radiotolerans} Back     alignment and structure
>3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>4etr_A Putative uncharacterized protein; DUF2383, domain of unknown function, cytoplasmic, unknown FU; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1zuj_A Hypothetical protein llacc01001955; oxidative stress, DPS, DNA binding, lactic acid bacteria, DN protein; 2.90A {Lactococcus lactis} SCOP: a.25.1.1 Back     alignment and structure
>1zs3_A Lactococcus lactis Mg1363 DPSA; oxidative stress, DNA binding, lactic acid bacteria, DNA binding protein; 2.70A {Lactococcus lactis} SCOP: a.25.1.1 Back     alignment and structure
>1o9i_A Pseudocatalase; oxidoreductase, hexamer, dimanganese catalase, metalloenzyme, preoxidase; HET: MES; 1.33A {Lactobacillus plantarum} SCOP: a.25.1.3 PDB: 1jkv_A 1jku_A Back     alignment and structure
>2v8t_A Manganese-containing pseudocatalase; manganese catalase, oxidoreductase; 0.98A {Thermus thermophilus} PDB: 2v8u_A 2cwl_A Back     alignment and structure
>3k6c_A Uncharacterized protein NE0167; structural genomics, MCSG, unknown function protein, PSI, PR structure initiative; 2.20A {Nitrosomonas europaea} Back     alignment and structure
>2ib0_A Conserved hypothetical alanine rich protein; 4-helix bundle, structural genomics, PSI-2, protein structur initiative; 2.00A {Mycobacterium tuberculosis} SCOP: a.25.1.9 Back     alignment and structure
>1zpy_A Hypothetical protein NE0167; structural genomics, MCSG, PSI, protein structure initiative; 2.20A {Nitrosomonas europaea atcc 19718} PDB: 3k6c_A Back     alignment and structure
>2gs4_A Protein YCIF; stress proteins, rubrerythrin, metal binding protein; 2.00A {Escherichia coli} SCOP: a.25.1.4 Back     alignment and structure
>2gyq_A YCFI, putative structural protein; structural genomics, APC6105, iron-binding, PSI, protein STR initiative; 1.40A {Rhodopseudomonas palustris} SCOP: a.25.1.4 Back     alignment and structure
>1jm0_A Protein (four-helix bundle model); alpha-helical bundle, protein design, de novo protein; 1.70A {Synthetic} SCOP: k.8.1.1 PDB: 1jmb_A 1ovu_A 1ovv_A 1lt1_A 1ec5_A 1nvo_A 1ovr_A 2kik_A 1u7j_A 1y47_A 1mft_A 1u7m_A Back     alignment and structure
>2uw1_A Desaturase, plastid delta4 multifunctional acyl-ACYL carrier desaturase; electron transfer, oxidoreductase, lipid synthesis, fatty AC biosynthesis; HET: GVM; 1.95A {Hedera helix} PDB: 2uw1_B* 1oq4_A 1oq7_A 1oq9_A 1oqb_A 2xz0_A* 2xz1_A* 1afr_A 2j2f_A Back     alignment and structure
>3ogh_B Protein YCIE; iron-binding, MCSG, four-helix-bundle, structural genomics, protein structure initiative; HET: MSE; 1.65A {Escherichia coli O6} Back     alignment and structure
>3q4o_A Uncharacterized protein MJ0754; ferritin-like protein, four-helix bundle, metal binding, DIN center, unknown function; HET: B3P; 1.34A {Methanocaldococcus jannaschii} PDB: 3q4q_A* 3q4r_A* 3q4n_A Back     alignment and structure
>1za0_A Possible acyl-[acyl-carrier protein] desaturase D (acyl-[ACP] desaturase) (stearoyl-ACP...; four-helix bundle, metal binding protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.25.1.2 Back     alignment and structure
>3hl1_A Ferritin like protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Caulobacter vibrioides} Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Back     alignment and structure
>4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>3hiu_A Uncharacterized protein; APC40011, XCC3681, xanthomonas campestris PV. campestris STR. ATCC 33913, structural genomics, PSI-2; HET: MSE; 1.85A {Xanthomonas campestris PV} Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Back     alignment and structure
>2itb_A TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative ATTH, structural genomics, joint center for structu genomics, JCSG; 2.05A {Pseudomonas putida} SCOP: a.25.1.7 Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} SCOP: a.25.1.1 Back     alignment and structure
>3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Back     alignment and structure
>3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* Back     alignment and structure
>3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Back     alignment and structure
>2e0z_A Virus-like particle; bacteriophage, HK97; 3.60A {Pyrococcus furiosus} Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 Back     alignment and structure
>4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>2c41_A DPS family DNA-binding stress response protein; iron-binding/oxidation protein, DPS (DNA-binding proteins from starved cells); HET: PG4 PGE; 1.81A {Thermosynechococcus elongatus} Back     alignment and structure
>2vxx_A Starvation induced DNA binding protein; stress response protein, DPS, oxidation, iron binding, ferroxidase centre; HET: PG4; 2.40A {Synechococcus elongatus} Back     alignment and structure
>3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A Back     alignment and structure
>4etr_A Putative uncharacterized protein; DUF2383, domain of unknown function, cytoplasmic, unknown FU; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d1z6oa1200 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper( 3e-46
d1z6om1191 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(T 3e-44
d1rcda_171 a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb 4e-42
d1lb3a_179 a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) 1e-41
d1bg7a_173 a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb 5e-41
d1r03a_171 a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), 8e-40
d1s3qa1162 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Arch 9e-32
d1vlga_164 a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritim 3e-31
d1euma_161 a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, 3e-31
d1krqa_165 a.25.1.1 (A:) Non-hem ferritin {Campylobacter jeju 5e-30
d2htna1158 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1 1e-15
d1jgca_160 a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rh 1e-14
d1nf4a_169 a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {De 7e-14
d2fkza1154 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1 6e-12
>d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} Length = 200 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: (Apo)ferritin
species: Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]

 Score =  152 bits (384), Expect = 3e-46
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 87  ARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAE 146
                       +     +    SY Y    AYF+       G +K FK+ S+E      
Sbjct: 17  GEYGSHGNVATELQAYAKLHLERSYDYLLSAAYFNNYQTNRAGFSKLFKKLSDEAWSKTI 76

Query: 147 KFMEYQNLRGGKVKLHSIMQPPSEF-DHAEKGDALYAMELALSLEKLTNEKLLSLHSVAD 205
             +++   RG K+         +E  ++  +   L A+  AL  +K   E+   +H  A 
Sbjct: 77  DIIKHVTKRGDKMNFDQHSTMKTERKNYTAENHELEALAKALDTQKELAERAFYIHREAT 136

Query: 206 RN----NDPQMAEFVESEFLGEQ 224
           RN    +DP++A+++E EF+ + 
Sbjct: 137 RNSQHLHDPEIAQYLEEEFIEDH 159
>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} Length = 191 Back     information, alignment and structure
>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 171 Back     information, alignment and structure
>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 173 Back     information, alignment and structure
>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 162 Back     information, alignment and structure
>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Length = 164 Back     information, alignment and structure
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Length = 165 Back     information, alignment and structure
>d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Length = 158 Back     information, alignment and structure
>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Length = 160 Back     information, alignment and structure
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Length = 169 Back     information, alignment and structure
>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d1rcda_171 (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 100.0
d1lb3a_179 (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090] 100.0
d1r03a_171 (Apo)ferritin {Human (Homo sapiens), mitocondial i 100.0
d1bg7a_173 (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 100.0
d1z6oa1200 (Apo)ferritin {Cabbage looper(Trichoplusia ni), L 100.0
d1krqa_165 Non-hem ferritin {Campylobacter jejuni [TaxId: 197 100.0
d1z6om1191 (Apo)ferritin {Cabbage looper(Trichoplusia ni), H 100.0
d1vlga_164 Non-hem ferritin {Thermotoga maritima [TaxId: 2336 100.0
d1euma_161 Non-hem ferritin {Escherichia coli, FtnA [TaxId: 5 100.0
d1s3qa1162 Non-hem ferritin {Archaeon Archaeoglobus fulgidus 100.0
d2fkza1154 Bacterioferritin (cytochrome b1) {Azotobacter vine 99.96
d1jgca_160 Bacterioferritin (cytochrome b1) {Rhodobacter caps 99.95
d2htna1158 Bacterioferritin (cytochrome b1) {Escherichia coli 99.95
d1nf4a_169 Bacterioferritin (cytochrome b1) {Desulfovibrio de 99.94
d1yuza1135 Nigerythrin, N-terminal domain {Desulfovibrio vulg 99.86
d1j30a_141 Hypothetical rubrerythrin {Archaeon Sulfolobus tok 99.85
d1lkoa1146 Rubrerythrin, N-terminal domain {Desulfovibrio vul 99.84
d1nnqa1133 Rubrerythrin, N-terminal domain {Archaeon Pyrococc 99.52
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 99.38
d1o9ra_162 Dodecameric ferritin homolog {Agrobacterium tumefa 99.19
d1jiga_146 Dodecameric ferritin homolog {Bacillus anthracis, 99.12
d1tjoa_180 Dodecameric ferritin homolog {Archaeon Halobacteri 99.09
d1ji5a_142 Dodecameric ferritin homolog {Bacillus anthracis, 99.08
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus f 99.07
d1umna_151 Dodecameric ferritin homolog {Streptococcus suis [ 99.05
d2fjca1151 Dodecameric ferritin homolog {Treponema pallidum, 98.98
d1n1qa_149 Dodecameric ferritin homolog {Bacillus brevis, Dps 98.94
d1ji4a_144 Dodecameric ferritin homolog {Helicobacter pylori, 98.86
d1vjxa_149 Hypothetical protein TM1526 {Thermotoga maritima [ 98.81
d2bk6a1150 Dodecameric ferritin homolog {Listeria innocua [Ta 98.71
d1dpsa_159 Dodecameric ferritin homolog {Escherichia coli, Dp 98.69
d2ib0a1142 Hypothetical protein Rv2844 {Mycobacterium tubercu 98.55
d2yw6a1141 Dodecameric ferritin homolog {Mycobacterium smegma 98.41
d1zs3a1171 Dodecameric ferritin homolog {Lactococcus lactis, 98.09
d1zuja1168 Dodecameric ferritin homolog {Lactococcus lactis, 97.94
d1jkva_266 Manganese catalase (T-catalase) {Lactobacillus pla 96.52
d2cwla1299 Manganese catalase (T-catalase) {Thermus thermophi 95.84
d1zpya191 Hypothetical protein NE0167 {Nitrosomonas europaea 95.47
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 94.43
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus f 91.68
d1yuza1135 Nigerythrin, N-terminal domain {Desulfovibrio vulg 91.1
d1lkoa1146 Rubrerythrin, N-terminal domain {Desulfovibrio vul 91.06
d2htna1158 Bacterioferritin (cytochrome b1) {Escherichia coli 90.62
d2itba1199 Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Ps 90.45
d1jgca_160 Bacterioferritin (cytochrome b1) {Rhodobacter caps 90.11
d2fkza1154 Bacterioferritin (cytochrome b1) {Azotobacter vine 89.56
d1za0a1267 Possible acyl-[acyl-carrier protein] desaturase {M 88.71
d1vjxa_149 Hypothetical protein TM1526 {Thermotoga maritima [ 88.59
d1afra_345 delta 9-stearoyl-acyl carrier protein desaturase { 87.81
d1nf4a_169 Bacterioferritin (cytochrome b1) {Desulfovibrio de 86.04
d1j30a_141 Hypothetical rubrerythrin {Archaeon Sulfolobus tok 81.39
>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: (Apo)ferritin
species: Bullfrog (Rana catesbeiana) [TaxId: 8400]

Probab=100.00  E-value=1.2e-42  Score=296.11  Aligned_cols=156  Identities=42%  Similarity=0.716  Sum_probs=143.9

Q ss_pred             hhhhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHcCCeeeeccc
Q 023956           85 SLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSI  164 (275)
Q Consensus        85 s~aRq~~s~e~e~aLNeQIn~EL~ASy~YlsmAayFdrd~v~L~GfAkfFr~~S~EEreHAekLikY~n~RGG~V~l~~I  164 (275)
                      |.+||||+++|+++||+|||.||+|||+|++||+||++++++|+||++||+.+|+|||+||++|++||++|||.|.+++|
T Consensus         1 ~~~r~n~~~e~~~aLN~qi~~El~as~~Yl~ma~~f~~~~~~l~g~a~~f~~~s~EE~~Ha~~l~~yi~~rgg~~~~~~i   80 (171)
T d1rcda_           1 SQVRQNFHQDCEAGLNRTVNLKFHSSYVYLSMASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRGGRVFLQSV   80 (171)
T ss_dssp             CTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCCC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCceeccc
Confidence            67999999999999999999999999999999999999899999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCChhHHHHhHHHhhhchhhhhHHHHHHHHHHHc---C
Q 023956          165 MQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQDYGTSIKCFSTRVMLH---D  241 (275)
Q Consensus       165 ~~P~~ef~~~e~g~~l~ale~AL~lEk~vt~~L~eL~~vA~~~~D~~t~dFLE~~FL~EQVEEe~Ik~l~d~l~~l---g  241 (275)
                      ++|+.    .+|.+++++|+.||++|+.+++.|++|+++|.+.+|+++.+||+.+||+||+  +.++++.++++++   |
T Consensus        81 ~~~~~----~~~~s~~e~~~~al~~Ek~v~~~l~~l~~~a~~~~D~~~~~fle~~fl~eQ~--e~~~~l~~~l~~l~~~~  154 (171)
T d1rcda_          81 EKPER----DDWANGLEALQTALKLQKSVNQALLDLHAVAADKSDPHMTDFLESPYLSESV--ETIKKLGDHITSLKKLW  154 (171)
T ss_dssp             CCCSC----SCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTHHHHHH--HHHHHHHHHHHHHHHHH
T ss_pred             CCCCC----ccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHhC
Confidence            88875    3567899999999999999999999999999999999999999977999999  7777777777655   5


Q ss_pred             CCCcc
Q 023956          242 EEPYC  246 (275)
Q Consensus       242 ~~~~~  246 (275)
                      .++.|
T Consensus       155 ~~~~g  159 (171)
T d1rcda_         155 SSHPG  159 (171)
T ss_dssp             TTCHH
T ss_pred             CCCch
Confidence            54433
>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} Back     information, alignment and structure
>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Back     information, alignment and structure
>d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} Back     information, alignment and structure
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} Back     information, alignment and structure
>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Back     information, alignment and structure
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} Back     information, alignment and structure
>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]} Back     information, alignment and structure
>d1tjoa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1ji5a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]} Back     information, alignment and structure
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1umna_ a.25.1.1 (A:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} Back     information, alignment and structure
>d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]} Back     information, alignment and structure
>d1ji4a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]} Back     information, alignment and structure
>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bk6a1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1dpsa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} Back     information, alignment and structure
>d2ib0a1 a.25.1.9 (A:17-158) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yw6a1 a.25.1.1 (A:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} Back     information, alignment and structure
>d1zs3a1 a.25.1.1 (A:3-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsB [TaxId: 1358]} Back     information, alignment and structure
>d1zuja1 a.25.1.1 (A:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]} Back     information, alignment and structure
>d1jkva_ a.25.1.3 (A:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2cwla1 a.25.1.3 (A:1-299) Manganese catalase (T-catalase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zpya1 a.25.1.5 (A:4-94) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2itba1 a.25.1.7 (A:3-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1za0a1 a.25.1.2 (A:8-274) Possible acyl-[acyl-carrier protein] desaturase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1afra_ a.25.1.2 (A:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure