Citrus Sinensis ID: 024005


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEQKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV
ccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccHHHHHHHHHHccccccHHHHHHHHcccccccccccccHHHHHccccEEccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccHHHHHcccccccccccccccccccccccccccccc
*SFVFR*SRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALD****************TLPV***************************************TEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWH*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEQKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase SDIR1 E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.confidentQ9M2S6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 151-174,205-258
View the alignment between query and template
View the model in PyMOL