Citrus Sinensis ID: 024019


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFVDNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEEGQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEWAFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLEEFHVGNEVKISFLSIFYSSCSVSDFTYLRCGIEH
ccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHcccccccccccccccHHHcHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccccccEEEcccccc
***RGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFVDNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEEGQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEWAFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLEEFHVGNEVKISFLSIFYSSCSVSDFTYLRCGIE*
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFVDNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEEGQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEWAFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLEEFHVGNEVKISFLSIFYSSCSVSDFTYLRCGIEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase SIS3 E3 ubiquitin protein ligase that acts as positive regulator of sugar signaling during early seedling development. Possesses E3 ligase activity in vitro.probableQ8GYT9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:confident
Coverage over the Query: 212-273
View the alignment between query and template
View the model in PyMOL