Citrus Sinensis ID: 024019
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 274 | ||||||
| 255540693 | 381 | protein binding protein, putative [Ricin | 0.908 | 0.653 | 0.915 | 1e-136 | |
| 356513598 | 382 | PREDICTED: E3 ubiquitin-protein ligase S | 0.908 | 0.651 | 0.907 | 1e-134 | |
| 225457054 | 381 | PREDICTED: E3 ubiquitin-protein ligase S | 0.908 | 0.653 | 0.927 | 1e-130 | |
| 297733794 | 277 | unnamed protein product [Vitis vinifera] | 0.905 | 0.895 | 0.931 | 1e-128 | |
| 356562736 | 383 | PREDICTED: E3 ubiquitin-protein ligase S | 0.908 | 0.650 | 0.891 | 1e-126 | |
| 224133512 | 333 | predicted protein [Populus trichocarpa] | 0.908 | 0.747 | 0.891 | 1e-124 | |
| 219886093 | 374 | unknown [Zea mays] | 0.901 | 0.660 | 0.851 | 1e-123 | |
| 449440682 | 377 | PREDICTED: E3 ubiquitin-protein ligase S | 0.908 | 0.660 | 0.859 | 1e-123 | |
| 357477371 | 365 | RING finger protein [Medicago truncatula | 0.846 | 0.635 | 0.896 | 1e-123 | |
| 115462059 | 386 | Os05g0145000 [Oryza sativa Japonica Grou | 0.905 | 0.642 | 0.871 | 1e-122 |
| >gi|255540693|ref|XP_002511411.1| protein binding protein, putative [Ricinus communis] gi|223550526|gb|EEF52013.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 490 bits (1261), Expect = e-136, Method: Compositional matrix adjust.
Identities = 228/249 (91%), Positives = 240/249 (96%)
Query: 1 MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFV 60
MAIRGVDFKWYDGFFLSMLATSV+IVAINWKRYH CTYPLHIWIVVDYTTVFVFRLLMF+
Sbjct: 1 MAIRGVDFKWYDGFFLSMLATSVVIVAINWKRYHHCTYPLHIWIVVDYTTVFVFRLLMFI 60
Query: 61 DNGLASGMGLDLGWQQRYARFCGRVVVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE 120
DNGLA+GMGLD GWQQRYARFCGR+ VLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE
Sbjct: 61 DNGLAAGMGLDFGWQQRYARFCGRIAVLSILSLLLYPFLWAWTIIGTLWFTSARDCLPEE 120
Query: 121 GQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEW 180
GQKWGFLIWL+FSYCGLLCIACM MGKWLTRRQAH +RAQQGIP+SEYGVL+DM+RVP+W
Sbjct: 121 GQKWGFLIWLVFSYCGLLCIACMCMGKWLTRRQAHLLRAQQGIPISEYGVLVDMVRVPDW 180
Query: 181 AFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLE 240
AFEAAGQEMRG+GQD AAYHPGLYLT QREAVEALIQELPKFRLK VPTDCSECPICLE
Sbjct: 181 AFEAAGQEMRGMGQDAAAYHPGLYLTPTQREAVEALIQELPKFRLKTVPTDCSECPICLE 240
Query: 241 EFHVGNEVK 249
EFHVGNEV+
Sbjct: 241 EFHVGNEVR 249
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356513598|ref|XP_003525499.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225457054|ref|XP_002282957.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297733794|emb|CBI15041.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356562736|ref|XP_003549625.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224133512|ref|XP_002321588.1| predicted protein [Populus trichocarpa] gi|222868584|gb|EEF05715.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|219886093|gb|ACL53421.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449440682|ref|XP_004138113.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Cucumis sativus] gi|449518937|ref|XP_004166492.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357477371|ref|XP_003608971.1| RING finger protein [Medicago truncatula] gi|355510026|gb|AES91168.1| RING finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|115462059|ref|NP_001054629.1| Os05g0145000 [Oryza sativa Japonica Group] gi|51038194|gb|AAT93997.1| unknow protein [Oryza sativa Japonica Group] gi|113578180|dbj|BAF16543.1| Os05g0145000 [Oryza sativa Japonica Group] gi|215706903|dbj|BAG93363.1| unnamed protein product [Oryza sativa Japonica Group] gi|222630174|gb|EEE62306.1| hypothetical protein OsJ_17095 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 274 | ||||||
| TAIR|locus:2097830 | 358 | SIS3 "SUGAR-INSENSITIVE 3" [Ar | 0.908 | 0.695 | 0.779 | 8.7e-111 | |
| GENEDB_PFALCIPARUM|PF10_0276 | 274 | PF10_0276 "hypothetical protei | 0.412 | 0.412 | 0.256 | 2.5e-10 | |
| UNIPROTKB|Q8IJC2 | 274 | PF10_0276 "Zinc finger, C3HC4 | 0.412 | 0.412 | 0.256 | 2.5e-10 |
| TAIR|locus:2097830 SIS3 "SUGAR-INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1094 (390.2 bits), Expect = 8.7e-111, P = 8.7e-111
Identities = 194/249 (77%), Positives = 214/249 (85%)
Query: 1 MAIRGVDFKWYDGFFLSMLATSVIIVAINWKRYHLCTYPLHIWIVVDYTTVFVFRLLMFV 60
MA+RGVDFKWYDGFFLSMLATSVIIVA+NW RY C YPLHIWIVVDYTTVF+FR+ MFV
Sbjct: 1 MAMRGVDFKWYDGFFLSMLATSVIIVAVNWNRYRACEYPLHIWIVVDYTTVFIFRVFMFV 60
Query: 61 DNGLASGMGLDLGWQQRYARFCGRXXXXXXXXXXXYPFLWAWTIIGTLWFTSARDCLPEE 120
DNGLASG+GLD G QQR A FCGR YPFLWAWT+IGT WFT ++ CLPEE
Sbjct: 61 DNGLASGLGLDFGSQQRNAMFCGRVVVLSVLSLLLYPFLWAWTVIGTQWFTKSKTCLPEE 120
Query: 121 GQKWGFLIWLLFSYCGLLCIACMSMGKWLTRRQAHSIRAQQGIPVSEYGVLLDMIRVPEW 180
GQKWGFLIWL+FSYCGLLCIA + +GKWLTRRQ H +RAQQGIP+SE+G+L+DMIRVP+W
Sbjct: 121 GQKWGFLIWLMFSYCGLLCIAFICVGKWLTRRQVHLLRAQQGIPISEFGILVDMIRVPDW 180
Query: 181 AFEAAGQEMRGIGQDTAAYHPGLYLTAAQREAVEALIQELPKFRLKAVPTDCSECPICLE 240
AFEAAGQEMRGI QD A YHPGLYLT AQ EAVEALIQELPKFRLKAVP DC EC ICLE
Sbjct: 181 AFEAAGQEMRGISQDAATYHPGLYLTPAQTEAVEALIQELPKFRLKAVPDDCGECLICLE 240
Query: 241 EFHVGNEVK 249
EFH+G+EV+
Sbjct: 241 EFHIGHEVR 249
|
|
| GENEDB_PFALCIPARUM|PF10_0276 PF10_0276 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJC2 PF10_0276 "Zinc finger, C3HC4 type, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.55 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.51 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.01 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.01 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.61 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.07 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 96.88 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.37 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 95.86 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 95.67 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.61 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.27 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 95.05 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 93.98 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 92.97 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 90.84 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 89.17 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 86.03 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 84.67 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 84.4 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 83.61 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 83.31 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 82.0 |
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.55 E-value=1e-14 Score=139.01 Aligned_cols=61 Identities=25% Similarity=0.419 Sum_probs=54.1
Q ss_pred HHHHHHhcCCceeeecCCCCC--cccccccccccccceeeecccC-cCCcCCcccccccccC-CC
Q 024019 212 AVEALIQELPKFRLKAVPTDC--SECPICLEEFHVGNEVKISFLS-IFYSSCSVSDFTYLRC-GI 272 (274)
Q Consensus 212 avEa~IqaLP~~~~t~~~~d~--~eCsICLedFe~GEevR~LPcC-~FH~~CI~~w~~~~~~-~~ 272 (274)
+.|++++++|..+++...++. ..|+||||||++||.+|.|||. .||..|||||++++|. ||
T Consensus 207 ~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CP 271 (348)
T KOG4628|consen 207 LIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCP 271 (348)
T ss_pred hHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCC
Confidence 456789999999998765432 3899999999999999999999 9999999999999987 88
|
|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 274 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 7e-05 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 3e-04 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
Score = 39.6 bits (93), Expect = 7e-05
Identities = 10/42 (23%), Positives = 15/42 (35%), Gaps = 3/42 (7%)
Query: 212 AVEALIQELPKFRLKA---VPTDCSECPICLEEFHVGNEVKI 250
A + I LP+ + CPIC E+ G+
Sbjct: 17 ASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATE 58
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.12 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.06 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.73 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.47 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.39 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.39 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.37 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.23 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.22 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.15 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.11 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.09 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.92 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.9 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.8 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.77 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.73 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.59 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.53 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.48 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.45 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.33 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.28 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.19 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.17 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 97.01 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.98 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 96.98 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 96.97 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 96.92 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 96.89 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 96.85 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 96.75 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 96.75 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 96.72 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 96.66 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 96.54 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.5 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.32 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 96.13 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 96.08 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 95.99 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 95.94 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 95.92 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 95.5 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 95.39 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 95.15 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 94.97 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 94.97 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 94.61 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 93.37 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 93.14 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 92.91 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 90.12 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 89.8 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 89.09 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 87.98 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 84.09 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 83.95 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 83.07 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 82.55 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 82.49 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 82.36 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 80.12 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.12 E-value=4.8e-12 Score=95.77 Aligned_cols=62 Identities=19% Similarity=0.213 Sum_probs=53.7
Q ss_pred HHHHHHhcCCceeeecCCC---CCcccccccccccccceeeecccC-cCCcCCcccccccccCCCC
Q 024019 212 AVEALIQELPKFRLKAVPT---DCSECPICLEEFHVGNEVKISFLS-IFYSSCSVSDFTYLRCGIE 273 (274)
Q Consensus 212 avEa~IqaLP~~~~t~~~~---d~~eCsICLedFe~GEevR~LPcC-~FH~~CI~~w~~~~~~~~~ 273 (274)
++++.|++||.+++++... +..+|+||+++|+.|+.++.|||- .||.+||..|+..++.||-
T Consensus 17 ~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~ 82 (91)
T 2l0b_A 17 ASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPV 82 (91)
T ss_dssp CCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTT
T ss_pred CCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcC
Confidence 4556899999999986532 336899999999999999999966 9999999999999999983
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 274 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.1 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.2 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.12 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.01 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.72 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.6 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.18 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.07 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.79 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.68 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.62 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 96.44 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 96.11 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 95.2 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 91.81 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 91.77 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 90.36 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.10 E-value=9.7e-12 Score=86.74 Aligned_cols=41 Identities=22% Similarity=0.289 Sum_probs=39.0
Q ss_pred CcccccccccccccceeeecccC--cCCcCCcccccccccCCC
Q 024019 232 CSECPICLEEFHVGNEVKISFLS--IFYSSCSVSDFTYLRCGI 272 (274)
Q Consensus 232 ~~eCsICLedFe~GEevR~LPcC--~FH~~CI~~w~~~~~~~~ 272 (274)
..+|+||+++|++||+++++|+| .||.+||..|++.+..||
T Consensus 5 ~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP 47 (55)
T d1iyma_ 5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCP 47 (55)
T ss_dssp SCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCS
T ss_pred CCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCC
Confidence 36899999999999999999988 999999999999999998
|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|