Citrus Sinensis ID: 024025

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MLCLFWVVCLFCVIISLKLFQLNDDNQGCDGSVLLDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVFGGPSWKVRLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN
ccHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccHHccHHHHHcccccccccHHHHHHHHHHccccccccEEccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccc
*LCLFWVVCLFCVIISLKLFQLNDDNQGCDGSVLLDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVFGGPSWKVRLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCLFWVVCLFCVIISLKLFQLNDDNQGCDGSVLLDDTANFIGEKTAVPNNNSARGFNVVDQIKANLEKACPRVVSCADILAIAARDSVVFGGPSWKVRLGRRDSTTASRAAANTSIPPPTSNLSALISSFSAQGLSLKNMVALAGGHTVGKARCTSFRGHIYNDSNIDTSFARSLQQRCPRRGNDNVLANLDRQTPTCFDNLYYKNLLNKKGLLHSDQELFNGNSADFLVKRYAASISVFFKDFARGMIKMGNIKPLTGSAGQIRINCRKIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidase A2 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableP80679
Peroxidase 52 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableQ9FLC0
Peroxidase E5 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableP59121

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.7Peroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PA2, chain A
Confidence level:very confident
Coverage over the Query: 8-273
View the alignment between query and template
View the model in PyMOL