Citrus Sinensis ID: 024046


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MGSLSEYQKLAQKKHEEEEEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKVGNFENYQSHI
cccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEcccccccEEccHHcccccccccccccHHHHHccccHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccCEEEcccHHHHHccccccccEEEccccccccccccEEEEEccccccccccc
*************************SHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKVGNFENYQSHI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSxxxxxxxxxxxxxxxxxxxxxYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKVGNFENYQSHI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavone 3'-O-methyltransferase 1 Methylates OH residues of flavonoid compounds. Substrate preference is quercetin > myricetin >> luteolin. Dihydroquercetin is not a substrate.probableQ9FK25
Anthranilate N-methyltransferase Involved in the biosynthesis of acridine alkaloids. N-methyltransferase with a strict substrate specificity for anthranilate. No activity with anthranilic acid methyl ester, anthraniloyl CoA, 3- or 4-amino-benzoic acid, salicylic acid, catechol, eugenol, caffeic acid, quercetin, theobromin, theophyllin, putrescine and nicotinic acid among others.probableA9X7L0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3REO, chain A
Confidence level:very confident
Coverage over the Query: 20-272
View the alignment between query and template
View the model in PyMOL