Citrus Sinensis ID: 024046
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| 342161927 | 364 | RecName: Full=Anthranilate N-methyltrans | 0.959 | 0.719 | 0.789 | 1e-113 | |
| 225453640 | 359 | PREDICTED: quercetin 3-O-methyltransfera | 0.952 | 0.724 | 0.593 | 1e-87 | |
| 224128073 | 358 | catechol o-methyltransferase related [Po | 0.897 | 0.684 | 0.612 | 2e-86 | |
| 147785075 | 382 | hypothetical protein VITISV_028012 [Viti | 0.893 | 0.638 | 0.589 | 4e-82 | |
| 225453636 | 358 | PREDICTED: quercetin 3-O-methyltransfera | 0.893 | 0.681 | 0.589 | 5e-82 | |
| 255548061 | 359 | o-methyltransferase, putative [Ricinus c | 0.915 | 0.696 | 0.590 | 6e-82 | |
| 224068173 | 359 | catechol o-methyltransferase [Populus tr | 0.897 | 0.682 | 0.580 | 1e-81 | |
| 145695037 | 353 | O-methyltransferase [Citrus sinensis x C | 0.890 | 0.688 | 0.564 | 1e-80 | |
| 357512657 | 362 | Caffeic acid 3-O-methyltransferase [Medi | 0.904 | 0.682 | 0.564 | 2e-80 | |
| 388494808 | 362 | unknown [Medicago truncatula] | 0.904 | 0.682 | 0.564 | 3e-80 |
| >gi|342161927|sp|A9X7L0.1|ANMT_RUTGR RecName: Full=Anthranilate N-methyltransferase; Short=RgANMT gi|115315700|gb|ABI93949.1| anthranilate N-methyltransferase [Ruta graveolens] | Back alignment and taxonomy information |
|---|
Score = 412 bits (1059), Expect = e-113, Method: Compositional matrix adjust.
Identities = 210/266 (78%), Positives = 232/266 (87%), Gaps = 4/266 (1%)
Query: 1 MGSLSEYQKLAQKKHEEEEEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKA--GE 58
MGSLSE + E EE+EEESYS AMQL+M +VLPMATQ+AIQLGVFEIIAKA G
Sbjct: 1 MGSLSESHTQYKHGVEVEEDEEESYSRAMQLSMAIVLPMATQSAIQLGVFEIIAKAPGGR 60
Query: 59 LSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSG--GERLYALNPVSKYFVSNK 116
LSA EIA LQAQN KAP+MLDRMLRLLVSHRVL+CSVSG GERLY L VSKYFV ++
Sbjct: 61 LSASEIATILQAQNPKAPVMLDRMLRLLVSHRVLDCSVSGPAGERLYGLTSVSKYFVPDQ 120
Query: 117 DGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEA 176
DGASLG+FMALPLDKVFMESW+G+K AVMEGGIPFNRVHGMHIFEYAS N +F++TYH A
Sbjct: 121 DGASLGNFMALPLDKVFMESWMGVKGAVMEGGIPFNRVHGMHIFEYASSNSKFSDTYHRA 180
Query: 177 MFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDA 236
MFNHSTIA++RILEHY+GF+NV +LVDVGGG GVTLSMI SKYP I+A+NFDLPHVVQDA
Sbjct: 181 MFNHSTIALKRILEHYKGFENVTKLVDVGGGLGVTLSMIASKYPHIQAINFDLPHVVQDA 240
Query: 237 PSYAGVEHVGGNMFESVPEGDAILMK 262
SY GVEHVGGNMFESVPEGDAILMK
Sbjct: 241 ASYPGVEHVGGNMFESVPEGDAILMK 266
|
Source: Ruta graveolens Species: Ruta graveolens Genus: Ruta Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225453640|ref|XP_002267179.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform 1 [Vitis vinifera] gi|147785074|emb|CAN75449.1| hypothetical protein VITISV_028011 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224128073|ref|XP_002320237.1| catechol o-methyltransferase related [Populus trichocarpa] gi|118481911|gb|ABK92890.1| unknown [Populus trichocarpa] gi|222861010|gb|EEE98552.1| catechol o-methyltransferase related [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147785075|emb|CAN75450.1| hypothetical protein VITISV_028012 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225453636|ref|XP_002266899.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255548061|ref|XP_002515087.1| o-methyltransferase, putative [Ricinus communis] gi|223545567|gb|EEF47071.1| o-methyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224068173|ref|XP_002302676.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844402|gb|EEE81949.1| catechol o-methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|145695037|gb|ABP94018.1| O-methyltransferase [Citrus sinensis x Citrus reticulata] | Back alignment and taxonomy information |
|---|
| >gi|357512657|ref|XP_003626617.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] gi|87240860|gb|ABD32718.1| O-methyltransferase, family 2; Dimerisation [Medicago truncatula] gi|355501632|gb|AES82835.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388494808|gb|AFK35470.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| TAIR|locus:2153423 | 363 | OMT1 "AT5G54160" [Arabidopsis | 0.860 | 0.647 | 0.564 | 2.4e-69 | |
| UNIPROTKB|Q84N28 | 360 | OMT1 "Flavone O-methyltransfer | 0.864 | 0.655 | 0.487 | 2.5e-58 | |
| UNIPROTKB|Q6ZD89 | 368 | ROMT-9 "Flavone 3'-O-methyltra | 0.864 | 0.641 | 0.460 | 3.4e-54 | |
| TAIR|locus:2204695 | 381 | AT1G77530 [Arabidopsis thalian | 0.860 | 0.616 | 0.468 | 1.5e-53 | |
| TAIR|locus:2204680 | 381 | AT1G77520 [Arabidopsis thalian | 0.835 | 0.598 | 0.485 | 7.2e-52 | |
| TAIR|locus:2164087 | 378 | AT5G53810 [Arabidopsis thalian | 0.857 | 0.619 | 0.452 | 4.6e-50 | |
| TAIR|locus:2199607 | 373 | IGMT1 "indole glucosinolate O- | 0.849 | 0.621 | 0.449 | 5.2e-49 | |
| TAIR|locus:2199587 | 373 | IGMT2 "indole glucosinolate O- | 0.849 | 0.621 | 0.449 | 6.7e-49 | |
| TAIR|locus:2199582 | 373 | IGMT4 "indole glucosinolate O- | 0.849 | 0.621 | 0.453 | 3.7e-48 | |
| TAIR|locus:2199597 | 373 | IGMT3 "indole glucosinolate O- | 0.849 | 0.621 | 0.437 | 6.9e-47 |
| TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 703 (252.5 bits), Expect = 2.4e-69, P = 2.4e-69
Identities = 136/241 (56%), Positives = 177/241 (73%)
Query: 28 AMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAP-EIAAQLQAQNVKAPMMLDRMLRLL 86
AMQLA VLPMA ++A++L + EI+AK G +P EIA++L +N +AP+MLDR+LRLL
Sbjct: 23 AMQLASASVLPMALKSALELDLLEIMAKNGSPMSPTEIASKLPTKNPEAPVMLDRILRLL 82
Query: 87 VSHRVLECS---VSGG--ERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLK 141
S+ VL CS +SG ER+Y L PV KY N+DG S+ + DKV MESW LK
Sbjct: 83 TSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLK 142
Query: 142 DAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERL 201
DA+++GGIPFN+ +GM FEY +PRFN+ ++ M NHSTI M++ILE Y+GF+ + L
Sbjct: 143 DAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSL 202
Query: 202 VDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILM 261
VDVGGG G TL MI SKYP +K +NFDLPHV++DAPS+ G+EHVGG+MF SVP+GDAI M
Sbjct: 203 VDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFM 262
Query: 262 K 262
K
Sbjct: 263 K 263
|
|
| UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164087 AT5G53810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199607 IGMT1 "indole glucosinolate O-methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199587 IGMT2 "indole glucosinolate O-methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199582 IGMT4 "indole glucosinolate O-methyltransferase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199597 IGMT3 "indole glucosinolate O-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| pfam00891 | 239 | pfam00891, Methyltransf_2, O-methyltransferase | 1e-73 | |
| pfam08100 | 50 | pfam08100, Dimerisation, Dimerisation domain | 2e-15 | |
| TIGR02716 | 306 | TIGR02716, C20_methyl_CrtF, C-20 methyltransferase | 5e-05 | |
| PRK00137 | 147 | PRK00137, rplI, 50S ribosomal protein L9; Reviewed | 4e-04 |
| >gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase | Back alignment and domain information |
|---|
Score = 224 bits (574), Expect = 1e-73
Identities = 81/164 (49%), Positives = 97/164 (59%)
Query: 99 GERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMH 158
G Y L P SK V +D SL + + D +ESW LKDAV EGG PF R GM
Sbjct: 3 GGEDYGLTPASKLLVKGEDSPSLAPLLLMYADPTLLESWAHLKDAVREGGPPFERAFGMP 62
Query: 159 IFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSK 218
FEY +P FN ++ AM HS + M++ILE F + LVDVGGG G + I
Sbjct: 63 FFEYLGADPEFNRVFNRAMAAHSRLVMKKILETAFDFSGLSSLVDVGGGTGALAAAIVRA 122
Query: 219 YPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMK 262
YP IK + FDLPHV+ DAPS VE VGG+ FESVPE DAIL+K
Sbjct: 123 YPHIKGIVFDLPHVIADAPSADRVEFVGGDFFESVPEADAILLK 166
|
This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239 |
| >gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|131763 TIGR02716, C20_methyl_CrtF, C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >gnl|CDD|234659 PRK00137, rplI, 50S ribosomal protein L9; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 100.0 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 100.0 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 100.0 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.02 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.02 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.99 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 98.95 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 98.89 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 98.85 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 98.84 | |
| PF08100 | 51 | Dimerisation: Dimerisation domain; InterPro: IPR01 | 98.82 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 98.82 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 98.81 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 98.8 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 98.79 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 98.79 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 98.73 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 98.71 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 98.71 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 98.71 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.7 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 98.7 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 98.7 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 98.67 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 98.66 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 98.65 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 98.64 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 98.63 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 98.61 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 98.61 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 98.61 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 98.61 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.58 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 98.57 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 98.56 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 98.56 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 98.55 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 98.52 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 98.49 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 98.46 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 98.44 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 98.43 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 98.41 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 98.41 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 98.41 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 98.39 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 98.38 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 98.37 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.37 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 98.36 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 98.36 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 98.34 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 98.33 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 98.31 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 98.3 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 98.29 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 98.29 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 98.28 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 98.28 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 98.27 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 98.26 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 98.26 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.26 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 98.24 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 98.24 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 98.24 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 98.23 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 98.22 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 98.21 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 98.2 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 98.2 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.2 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.19 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 98.17 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 98.16 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 98.15 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 98.15 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 98.15 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 98.12 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 98.11 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 98.08 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 98.07 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.07 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 98.06 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.06 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 98.03 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 98.03 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 97.99 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 97.98 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 97.96 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 97.94 | |
| PLN02366 | 308 | spermidine synthase | 97.94 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 97.93 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 97.92 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.91 | |
| PRK04266 | 226 | fibrillarin; Provisional | 97.9 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 97.85 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.83 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 97.82 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 97.81 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.81 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 97.8 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.79 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 97.78 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.78 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 97.78 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 97.75 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 97.72 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 97.69 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 97.68 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 97.66 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 97.66 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 97.65 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 97.65 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 97.64 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.62 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 97.6 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 97.59 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 97.59 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 97.52 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 97.52 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 97.51 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 97.5 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 97.48 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 97.46 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 97.45 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 97.44 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 97.41 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 97.4 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 97.39 | |
| PLN02823 | 336 | spermine synthase | 97.36 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 97.34 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 97.34 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 97.33 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 97.3 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 97.3 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 97.27 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 97.26 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 97.25 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 97.25 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 97.24 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 97.24 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 97.23 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 97.23 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 97.2 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 97.16 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 97.15 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 97.11 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 97.11 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 97.08 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 97.07 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.02 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 96.99 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 96.99 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 96.96 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 96.95 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 96.91 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 96.91 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 96.9 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 96.88 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 96.86 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 96.86 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 96.85 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 96.84 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 96.84 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 96.81 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 96.79 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 96.77 | |
| PF14947 | 77 | HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ | 96.77 | |
| PHA00738 | 108 | putative HTH transcription regulator | 96.74 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 96.73 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 96.71 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 96.69 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 96.69 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 96.69 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 96.67 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 96.66 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 96.65 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 96.64 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 96.64 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 96.6 | |
| PRK11569 | 274 | transcriptional repressor IclR; Provisional | 96.6 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 96.57 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 96.55 | |
| PF13601 | 80 | HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 | 96.55 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 96.52 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 96.51 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 96.48 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 96.45 | |
| PLN02476 | 278 | O-methyltransferase | 96.43 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 96.43 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 96.42 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 96.41 | |
| TIGR02337 | 118 | HpaR homoprotocatechuate degradation operon regula | 96.41 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 96.4 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 96.37 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 96.35 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 96.34 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 96.27 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 96.25 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 96.25 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 96.19 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 96.18 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 96.08 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 96.07 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.02 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 96.01 | |
| COG2345 | 218 | Predicted transcriptional regulator [Transcription | 96.0 | |
| PRK03902 | 142 | manganese transport transcriptional regulator; Pro | 95.98 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 95.97 | |
| TIGR02702 | 203 | SufR_cyano iron-sulfur cluster biosynthesis transc | 95.93 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 95.92 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 95.92 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 95.92 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 95.9 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 95.81 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 95.81 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 95.78 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 95.76 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 95.76 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 95.76 | |
| PRK10857 | 164 | DNA-binding transcriptional regulator IscR; Provis | 95.7 | |
| COG4742 | 260 | Predicted transcriptional regulator [Transcription | 95.69 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 95.69 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 95.61 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 95.6 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 95.6 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 95.54 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 95.54 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 95.49 | |
| COG4190 | 144 | Predicted transcriptional regulator [Transcription | 95.48 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 95.46 | |
| COG4189 | 308 | Predicted transcriptional regulator [Transcription | 95.46 | |
| PF01638 | 90 | HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 | 95.45 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 95.43 | |
| TIGR02010 | 135 | IscR iron-sulfur cluster assembly transcription fa | 95.42 | |
| TIGR01884 | 203 | cas_HTH CRISPR locus-related DNA-binding protein. | 95.4 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 95.34 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 95.32 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 95.26 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 95.19 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 95.04 | |
| PRK11512 | 144 | DNA-binding transcriptional repressor MarR; Provis | 95.04 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 95.0 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 95.0 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 94.98 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 94.98 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 94.98 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 94.96 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 94.93 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 94.92 | |
| COG1321 | 154 | TroR Mn-dependent transcriptional regulator [Trans | 94.88 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 94.87 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 94.87 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 94.82 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 94.8 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 94.6 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 94.6 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 94.45 | |
| PF07381 | 90 | DUF1495: Winged helix DNA-binding domain (DUF1495) | 94.44 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 94.44 | |
| PRK11920 | 153 | rirA iron-responsive transcriptional regulator; Re | 94.44 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 94.34 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 94.33 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 94.31 | |
| COG1959 | 150 | Predicted transcriptional regulator [Transcription | 94.28 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 94.2 | |
| PF10007 | 92 | DUF2250: Uncharacterized protein conserved in arch | 94.18 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 94.17 | |
| PF06163 | 127 | DUF977: Bacterial protein of unknown function (DUF | 94.15 | |
| PF08461 | 66 | HTH_12: Ribonuclease R winged-helix domain; InterP | 94.09 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 93.97 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 93.78 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 93.78 | |
| COG3432 | 95 | Predicted transcriptional regulator [Transcription | 93.71 | |
| PRK14165 | 217 | winged helix-turn-helix domain-containing protein/ | 93.7 | |
| PF07789 | 155 | DUF1627: Protein of unknown function (DUF1627); In | 93.55 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 93.48 | |
| PRK15431 | 78 | ferrous iron transport protein FeoC; Provisional | 93.29 | |
| PRK11014 | 141 | transcriptional repressor NsrR; Provisional | 93.27 | |
| smart00529 | 96 | HTH_DTXR Helix-turn-helix diphteria tox regulatory | 93.22 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 93.15 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 92.86 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 92.85 | |
| PRK04172 | 489 | pheS phenylalanyl-tRNA synthetase subunit alpha; P | 92.74 | |
| PHA02943 | 165 | hypothetical protein; Provisional | 92.71 | |
| PRK06474 | 178 | hypothetical protein; Provisional | 92.67 | |
| COG1378 | 247 | Predicted transcriptional regulators [Transcriptio | 92.63 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 92.54 | |
| PRK03573 | 144 | transcriptional regulator SlyA; Provisional | 92.48 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 92.38 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 92.36 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 92.16 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 92.15 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 92.14 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 92.11 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 91.98 | |
| PRK13777 | 185 | transcriptional regulator Hpr; Provisional | 91.94 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 91.85 | |
| PF02002 | 105 | TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 | 91.66 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 91.62 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 91.48 | |
| PF14394 | 171 | DUF4423: Domain of unknown function (DUF4423) | 91.42 | |
| PLN02668 | 386 | indole-3-acetate carboxyl methyltransferase | 91.41 | |
| COG1846 | 126 | MarR Transcriptional regulators [Transcription] | 91.18 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 91.15 | |
| PRK05638 | 442 | threonine synthase; Validated | 91.1 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 90.83 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 90.73 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 90.69 | |
| PRK10870 | 176 | transcriptional repressor MprA; Provisional | 90.6 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 90.17 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 90.11 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 90.04 | |
| PF08221 | 62 | HTH_9: RNA polymerase III subunit RPC82 helix-turn | 90.02 | |
| PLN02853 | 492 | Probable phenylalanyl-tRNA synthetase alpha chain | 89.99 | |
| COG5631 | 199 | Predicted transcription regulator, contains HTH do | 89.89 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 89.85 | |
| PF04182 | 75 | B-block_TFIIIC: B-block binding subunit of TFIIIC; | 89.61 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 89.37 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 89.24 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 88.97 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 88.91 | |
| PRK13509 | 251 | transcriptional repressor UlaR; Provisional | 88.75 | |
| COG1733 | 120 | Predicted transcriptional regulators [Transcriptio | 88.75 | |
| TIGR02787 | 251 | codY_Gpos GTP-sensing transcriptional pleiotropic | 88.66 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 88.65 | |
| COG2512 | 258 | Predicted membrane-associated trancriptional regul | 88.32 | |
| PF03492 | 334 | Methyltransf_7: SAM dependent carboxyl methyltrans | 88.28 | |
| TIGR00498 | 199 | lexA SOS regulatory protein LexA. LexA acts as a h | 88.27 | |
| COG1497 | 260 | Predicted transcriptional regulator [Transcription | 88.26 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 87.31 | |
| PF03444 | 78 | HrcA_DNA-bdg: Winged helix-turn-helix transcriptio | 87.01 | |
| COG1675 | 176 | TFA1 Transcription initiation factor IIE, alpha su | 86.59 | |
| PRK10906 | 252 | DNA-binding transcriptional repressor GlpR; Provis | 86.48 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 86.36 | |
| PF02295 | 66 | z-alpha: Adenosine deaminase z-alpha domain; Inter | 86.32 | |
| PRK10434 | 256 | srlR DNA-bindng transcriptional repressor SrlR; Pr | 86.19 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 85.82 | |
| PTZ00326 | 494 | phenylalanyl-tRNA synthetase alpha chain; Provisio | 85.55 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 85.43 | |
| TIGR02147 | 271 | Fsuc_second hypothetical protein, TIGR02147. This | 85.41 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 85.36 | |
| PRK09802 | 269 | DNA-binding transcriptional regulator AgaR; Provis | 85.35 | |
| PF05732 | 165 | RepL: Firmicute plasmid replication protein (RepL) | 85.34 | |
| PF04072 | 183 | LCM: Leucine carboxyl methyltransferase; InterPro: | 85.24 | |
| PRK10411 | 240 | DNA-binding transcriptional activator FucR; Provis | 85.1 | |
| KOG3924 | 419 | consensus Putative protein methyltransferase invol | 84.58 | |
| KOG4058 | 199 | consensus Uncharacterized conserved protein [Funct | 84.44 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 83.98 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 83.97 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 83.81 | |
| PRK09775 | 442 | putative DNA-binding transcriptional regulator; Pr | 83.73 | |
| PF05584 | 72 | Sulfolobus_pRN: Sulfolobus plasmid regulatory prot | 83.72 | |
| COG0640 | 110 | ArsR Predicted transcriptional regulators [Transcr | 83.68 | |
| PF12324 | 77 | HTH_15: Helix-turn-helix domain of alkylmercury ly | 83.65 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 83.61 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 83.56 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 83.48 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 83.48 | |
| KOG4589 | 232 | consensus Cell division protein FtsJ [Cell cycle c | 83.46 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 83.24 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 83.2 | |
| PF04989 | 206 | CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 | 82.95 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 82.35 | |
| COG1349 | 253 | GlpR Transcriptional regulators of sugar metabolis | 82.25 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 81.66 | |
| PRK04214 | 412 | rbn ribonuclease BN/unknown domain fusion protein; | 81.64 | |
| PRK00135 | 188 | scpB segregation and condensation protein B; Revie | 81.0 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 80.73 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 80.66 | |
| TIGR02698 | 130 | CopY_TcrY copper transport repressor, CopY/TcrY fa | 80.4 | |
| KOG2915 | 314 | consensus tRNA(1-methyladenosine) methyltransferas | 80.37 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 80.33 |
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-36 Score=266.71 Aligned_cols=249 Identities=47% Similarity=0.789 Sum_probs=223.3
Q ss_pred hhHHHHHHHHHHhhhhHHHHHHHHHHhChhHHHHhCCCCCHHHHHHHhCc-CCCCCcchHHHHHHHHhcCCceeccccCC
Q 024046 21 EEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQA-QNVKAPMMLDRMLRLLVSHRVLECSVSGG 99 (273)
Q Consensus 21 ~~~~~~~l~~~~~g~~~~~aL~~a~elglfd~L~~~g~~t~~eLA~~~g~-~~~~~~~~l~rlL~~L~~~gll~~~~~~~ 99 (273)
+..+..+++++++++..++++.+|+|||+||+|.+.++ ..|+|-.+-. .++.++..+.|+||.|++.+++...-.+.
T Consensus 3 e~~~~l~~~~l~~~~~~~~~lk~A~eL~v~d~l~~~~~--p~~ia~~l~~~~~~~~p~ll~r~lr~L~s~~i~k~~~~~~ 80 (342)
T KOG3178|consen 3 ENEASLRAMRLANGFALPMVLKAACELGVFDILANAGS--PSEIASLLPTPKNPEAPVLLDRILRLLVSYSILKCRLVGG 80 (342)
T ss_pred hhHHHHHHHHHHhhhhhHHHHHHHHHcChHHHHHhCCC--HHHHHHhccCCCCCCChhHHHHHHHHHHHhhhceeeeecc
Confidence 45677899999999999999999999999999999644 8888888874 35568889999999999999999742112
Q ss_pred CcceecChhchHhhcCCCCCccchhhcccCChhHHHHhhhHHHHHhcCCCcchhccCCchhhhhhcCcchHHHHHHHHHh
Q 024046 100 ERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFN 179 (273)
Q Consensus 100 ~~~y~lt~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~e~l~~g~~~~~~~~g~~~~~~~~~~~~~~~~f~~am~~ 179 (273)
. .|.++|+++.+.++.+..++..+....+++..++.|..+.++++.++.+|..++|+..|+|...++.....|+.+|..
T Consensus 81 ~-~Y~~~~~~~~~l~~~~~~S~a~~~~~~~~~v~~~~w~~l~dai~eg~~~~~~~~G~~l~~~~~~~~~~~~~~~~sm~~ 159 (342)
T KOG3178|consen 81 E-VYSATPVCKYFLKDSGGGSLAPLVLLNTSKVIMNTWQFLKDAILEGGDAFATAHGMMLGGYGGADERFSKDFNGSMSF 159 (342)
T ss_pred e-eeeccchhhhheecCCCCchhHHHHHhcccchhhhHHHHHHHHHhcccCCccccchhhhhhcccccccHHHHHHHHHH
Confidence 2 799999999888776656778888777788889999999999999999999999988999998888888899999999
Q ss_pred cchhhHHHHHhhcccCCCcceEEEecCCccHHHHHHHHHCCCCeEEEeechHHHHhCCCC-CCceEEEcccCCCCCCCCE
Q 024046 180 HSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSY-AGVEHVGGNMFESVPEGDA 258 (273)
Q Consensus 180 ~~~~~~~~il~~~~~~~~~~~vvDVGGG~G~~~~~l~~~~P~l~~~~~Dlp~v~~~a~~~-~ri~~~~gD~f~~~p~~D~ 258 (273)
.+....+.+++.+..|++....||||||.|..+..++..||+++++.+|+|.|++.+... ++|+.+.||+|.+.|++|+
T Consensus 160 l~~~~~~~il~~~~Gf~~v~~avDvGgGiG~v~k~ll~~fp~ik~infdlp~v~~~a~~~~~gV~~v~gdmfq~~P~~da 239 (342)
T KOG3178|consen 160 LSTLVMKKILEVYTGFKGVNVAVDVGGGIGRVLKNLLSKYPHIKGINFDLPFVLAAAPYLAPGVEHVAGDMFQDTPKGDA 239 (342)
T ss_pred HHHHHHHhhhhhhcccccCceEEEcCCcHhHHHHHHHHhCCCCceeecCHHHHHhhhhhhcCCcceecccccccCCCcCe
Confidence 999888888898887889999999999999999999999999999999999999999988 9999999999999999999
Q ss_pred EEecccccccCCCC
Q 024046 259 ILMKVGNFENYQSH 272 (273)
Q Consensus 259 ~~l~~vLHd~~~~~ 272 (273)
|++.+|||||+|++
T Consensus 240 I~mkWiLhdwtDed 253 (342)
T KOG3178|consen 240 IWMKWILHDWTDED 253 (342)
T ss_pred EEEEeecccCChHH
Confidence 99999999999985
|
|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK11569 transcriptional repressor IclR; Provisional | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG2345 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK03902 manganese transport transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >PRK10857 DNA-binding transcriptional regulator IscR; Provisional | Back alignment and domain information |
|---|
| >COG4742 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >COG4190 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >COG4189 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR | Back alignment and domain information |
|---|
| >TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK11512 DNA-binding transcriptional repressor MarR; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG1321 TroR Mn-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PRK11920 rirA iron-responsive transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >COG1959 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >COG3432 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional | Back alignment and domain information |
|---|
| >PF07789 DUF1627: Protein of unknown function (DUF1627); InterPro: IPR012432 This is a group of sequences found in hypothetical proteins predicted to be expressed in a number of bacterial species | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15431 ferrous iron transport protein FeoC; Provisional | Back alignment and domain information |
|---|
| >PRK11014 transcriptional repressor NsrR; Provisional | Back alignment and domain information |
|---|
| >smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PHA02943 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06474 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1378 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >PRK03573 transcriptional regulator SlyA; Provisional | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PRK13777 transcriptional regulator Hpr; Provisional | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF14394 DUF4423: Domain of unknown function (DUF4423) | Back alignment and domain information |
|---|
| >PLN02668 indole-3-acetate carboxyl methyltransferase | Back alignment and domain information |
|---|
| >COG1846 MarR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK05638 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10870 transcriptional repressor MprA; Provisional | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PF08221 HTH_9: RNA polymerase III subunit RPC82 helix-turn-helix domain; InterPro: IPR013197 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain | Back alignment and domain information |
|---|
| >COG5631 Predicted transcription regulator, contains HTH domain (MarR family) [Transcription] | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >PRK13509 transcriptional repressor UlaR; Provisional | Back alignment and domain information |
|---|
| >COG1733 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >COG2512 Predicted membrane-associated trancriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine | Back alignment and domain information |
|---|
| >TIGR00498 lexA SOS regulatory protein LexA | Back alignment and domain information |
|---|
| >COG1497 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress | Back alignment and domain information |
|---|
| >COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] | Back alignment and domain information |
|---|
| >PRK10906 DNA-binding transcriptional repressor GlpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PF02295 z-alpha: Adenosine deaminase z-alpha domain; InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3 | Back alignment and domain information |
|---|
| >PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >TIGR02147 Fsuc_second hypothetical protein, TIGR02147 | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09802 DNA-binding transcriptional regulator AgaR; Provisional | Back alignment and domain information |
|---|
| >PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication | Back alignment and domain information |
|---|
| >PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues | Back alignment and domain information |
|---|
| >PRK10411 DNA-binding transcriptional activator FucR; Provisional | Back alignment and domain information |
|---|
| >KOG3924 consensus Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG4058 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09775 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus | Back alignment and domain information |
|---|
| >COG0640 ArsR Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00135 scpB segregation and condensation protein B; Reviewed | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family | Back alignment and domain information |
|---|
| >KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 273 | ||||
| 1kyw_A | 365 | Crystal Structure Analysis Of Caffeic Acid5-Hydroxy | 2e-74 | ||
| 3reo_A | 368 | Monolignol O-Methyltransferase (Momt) Length = 368 | 8e-73 | ||
| 3p9c_A | 364 | Crystal Structure Of Perennial Ryegrass Lpomt1 Boun | 3e-66 | ||
| 1fp1_D | 372 | Crystal Structure Analysis Of Chalcone O-Methyltran | 3e-50 | ||
| 1fpq_A | 372 | Crystal Structure Analysis Of Selenomethionine Subs | 5e-41 | ||
| 1fp2_A | 352 | Crystal Structure Analysis Of Isoflavone O-Methyltr | 2e-20 | ||
| 2qyo_A | 357 | Crystal Structure Of Isoflavone O-Methyltransferase | 2e-19 | ||
| 1fpx_A | 352 | Crystal Structure Analysis Of Selenomethionine Subs | 1e-17 | ||
| 1zgj_A | 354 | Crystal Structure Of Isoflavanone 4'-O-Methyltransf | 1e-12 | ||
| 1zg3_A | 358 | Crystal Structure Of The Isoflavanone 4'-O-Methyltr | 1e-12 | ||
| 1zga_A | 357 | Crystal Structure Of Isoflavanone 4'-o-methyltransf | 1e-12 | ||
| 4a6d_A | 353 | Crystal Structure Of Human N-Acetylserotonin Methyl | 1e-06 | ||
| 3gwz_A | 369 | Structure Of The Mitomycin 7-O-Methyltransferase Mm | 1e-06 | ||
| 1x19_A | 359 | Crystal Structure Of Bchu Involved In Bacteriochlor | 3e-05 | ||
| 2ip2_A | 334 | Structure Of The Pyocyanin Biosynthetic Protein Phz | 1e-04 | ||
| 1tw2_A | 360 | Crystal Structure Of Carminomycin-4-O-Methyltransfe | 2e-04 |
| >pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 | Back alignment and structure |
|
| >pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 | Back alignment and structure |
| >pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 | Back alignment and structure |
| >pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 | Back alignment and structure |
| >pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 | Back alignment and structure |
| >pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 | Back alignment and structure |
| >pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 | Back alignment and structure |
| >pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 | Back alignment and structure |
| >pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 | Back alignment and structure |
| >pdb|4A6D|A Chain A, Crystal Structure Of Human N-Acetylserotonin Methyltransferase (Asmt) In Complex With Sam Length = 353 | Back alignment and structure |
| >pdb|3GWZ|A Chain A, Structure Of The Mitomycin 7-O-Methyltransferase Mmcr Length = 369 | Back alignment and structure |
| >pdb|1X19|A Chain A, Crystal Structure Of Bchu Involved In Bacteriochlorophyll C Biosynthesis Length = 359 | Back alignment and structure |
| >pdb|2IP2|A Chain A, Structure Of The Pyocyanin Biosynthetic Protein Phzm Length = 334 | Back alignment and structure |
| >pdb|1TW2|A Chain A, Crystal Structure Of Carminomycin-4-O-Methyltransferase (Dnrk) In Complex With S-Adenosyl-L-Homocystein (Sah) And 4-Methoxy-E-Rhodomycin T (M-Et) Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 1e-102 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 5e-98 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 1e-97 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 2e-92 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 1e-90 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 8e-88 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 4e-87 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 1e-86 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 1e-86 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 9e-86 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 1e-81 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 1e-66 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 2e-63 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 2e-60 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 5e-58 |
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 | Back alignment and structure |
|---|
Score = 301 bits (773), Expect = e-102
Identities = 135/271 (49%), Positives = 184/271 (67%), Gaps = 12/271 (4%)
Query: 1 MGSLSEYQKLAQKKHEEEEEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKA---- 56
MGS + + +EE+ AMQLA VLPMA +AAI+L V EI+AK+
Sbjct: 1 MGSTGNAE---IQIIPTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPS 57
Query: 57 GELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSV-----SGGERLYALNPVSKY 111
G +S EIAAQL N +AP+MLDR+LRLL S+ V+ ++ ERLY L PV K+
Sbjct: 58 GYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGKVERLYGLAPVCKF 117
Query: 112 FVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNE 171
N+DG SL F+ L DKV +E W LKDA++EGGIPFN+ +GM+IF+Y + R N+
Sbjct: 118 LTKNEDGVSLAPFLLLATDKVLLEPWFYLKDAILEGGIPFNKAYGMNIFDYHGTDHRINK 177
Query: 172 TYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPH 231
+++ M ++STI M++ILE Y GF+ + +VDVGGG G SMI +KYP I A+NFDLPH
Sbjct: 178 VFNKGMSSNSTITMKKILEMYNGFEGLTTIVDVGGGTGAVASMIVAKYPSINAINFDLPH 237
Query: 232 VVQDAPSYAGVEHVGGNMFESVPEGDAILMK 262
V+QDAP+++GVEH+GG+MF+ VP+GDAI +K
Sbjct: 238 VIQDAPAFSGVEHLGGDMFDGVPKGDAIFIK 268
|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 100.0 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 100.0 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 100.0 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 100.0 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 100.0 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 100.0 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 100.0 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 100.0 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 100.0 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 100.0 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 100.0 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 100.0 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 100.0 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 100.0 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 100.0 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 100.0 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 99.39 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.04 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.02 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 98.98 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.97 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 98.96 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 98.93 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 98.93 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 98.89 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 98.88 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 98.86 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 98.86 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 98.86 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 98.85 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 98.85 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 98.83 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 98.83 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 98.83 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 98.83 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 98.82 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 98.82 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 98.81 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 98.8 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 98.8 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 98.79 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 98.79 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 98.77 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 98.77 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 98.76 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 98.74 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 98.72 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 98.72 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 98.72 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 98.71 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 98.71 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 98.7 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 98.7 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 98.7 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 98.7 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 98.7 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 98.68 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 98.67 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 98.66 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 98.66 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 98.66 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 98.66 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 98.65 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 98.64 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 98.63 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 98.62 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 98.62 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 98.6 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.59 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.59 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 98.57 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 98.57 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 98.57 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 98.56 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 98.56 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 98.55 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 98.54 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 98.53 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 98.53 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 98.53 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 98.52 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 98.52 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 98.52 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 98.51 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 98.51 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 98.5 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 98.49 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 98.49 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.49 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 98.49 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.47 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 98.47 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 98.47 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 98.47 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 98.47 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.46 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.46 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 98.45 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 98.45 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.45 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 98.44 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 98.44 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.43 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 98.42 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 98.42 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 98.42 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 98.41 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 98.41 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 98.41 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 98.41 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.4 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 98.4 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 98.4 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.39 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 98.39 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 98.38 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 98.37 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 98.37 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 98.37 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 98.36 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 98.34 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 98.34 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 98.33 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 98.33 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 98.32 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 98.31 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 98.31 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 98.3 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 98.3 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 98.29 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 98.29 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 98.29 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 98.29 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 98.28 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 98.28 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 98.28 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 98.27 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 98.27 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 98.26 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 98.26 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 98.26 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 98.26 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 98.26 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 98.25 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 98.25 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 98.25 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 98.25 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 98.25 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 98.25 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.24 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.23 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 98.23 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.23 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.22 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 98.21 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 98.2 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 98.2 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 98.19 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 98.18 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 98.18 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 98.18 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 98.17 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 98.17 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 98.17 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 98.16 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 98.16 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 98.16 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 98.15 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 98.15 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 98.14 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 98.13 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 98.13 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 98.13 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 98.13 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 98.13 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.11 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 98.11 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 98.1 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 98.09 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 98.09 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.09 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.09 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 98.08 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 98.07 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.06 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 98.06 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 98.05 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 98.05 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 98.05 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 98.04 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 98.04 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 98.04 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 98.03 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 98.03 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 98.02 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 98.02 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 98.02 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 98.02 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 98.02 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 98.0 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 98.0 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 98.0 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 97.99 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 97.99 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 97.98 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 97.98 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 97.97 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 97.97 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 97.97 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 97.96 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 97.96 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 97.96 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 97.95 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.95 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 97.93 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 97.92 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 97.92 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.91 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 97.9 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 97.9 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 97.9 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 97.89 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 97.87 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 97.87 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 97.86 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 97.82 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 97.82 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 97.82 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.8 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 97.79 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 97.79 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 97.77 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 97.72 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 97.72 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.71 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 97.68 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 97.67 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.66 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 97.66 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 97.66 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 97.65 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 97.65 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 97.59 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.57 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 97.54 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 97.51 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 97.49 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.49 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 97.48 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 97.37 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 97.36 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 97.36 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 97.33 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 97.29 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 97.28 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 97.27 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 97.18 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 97.18 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 97.17 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 97.17 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 97.15 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 97.15 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 97.15 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 97.09 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 97.07 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 97.07 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 97.07 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 97.06 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 97.06 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 97.06 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 97.05 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 97.02 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 97.02 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.01 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 97.01 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 96.95 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 96.94 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 96.9 | |
| 3df8_A | 111 | Possible HXLR family transcriptional factor; APC89 | 96.88 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 96.87 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 96.85 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 96.84 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 96.84 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 96.83 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 96.8 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 96.77 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 96.75 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 96.74 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 96.65 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 96.65 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 96.64 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 96.64 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 96.62 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 96.59 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 96.59 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 96.58 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 96.57 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 96.57 | |
| 1r7j_A | 95 | Conserved hypothetical protein SSO10A; winged heli | 96.56 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 96.56 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 96.55 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 96.54 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 96.53 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 96.47 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 96.47 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 96.45 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 96.44 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 96.43 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 96.42 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 96.33 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 96.33 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 96.28 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 96.28 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 96.25 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 96.21 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 96.19 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 96.18 | |
| 3kp7_A | 151 | Transcriptional regulator TCAR; multiple drug resi | 96.1 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 96.1 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 96.07 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 96.07 | |
| 1yyv_A | 131 | Putative transcriptional regulator; reductive meth | 96.06 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 96.05 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 96.04 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 96.03 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 96.02 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 96.01 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 95.99 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 95.99 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 95.98 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 95.98 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 95.97 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 95.96 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 95.96 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 95.94 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 95.93 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 95.91 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 95.9 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 95.84 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 95.83 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 95.8 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 95.79 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 95.76 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 95.72 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 95.71 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 95.7 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 95.66 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 95.65 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 95.64 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 95.61 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 95.6 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 95.59 | |
| 1bja_A | 95 | Transcription regulatory protein MOTA; activation | 95.59 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 95.58 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 95.57 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 95.57 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 95.52 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 95.5 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 95.49 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 95.48 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 95.48 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 95.45 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 95.44 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 95.43 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 95.42 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 95.39 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 95.29 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 95.27 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 95.22 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 95.22 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 95.17 | |
| 3lwf_A | 159 | LIN1550 protein, putative transcriptional regulato | 95.15 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 95.13 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 95.11 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 95.08 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 95.07 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 95.04 | |
| 2obp_A | 96 | Putative DNA-binding protein; structural genomics, | 94.99 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 94.98 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 94.94 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 94.91 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 94.9 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 94.87 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 94.83 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 94.8 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 94.78 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 94.73 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 94.72 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 94.64 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 94.62 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 94.58 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 94.54 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 94.52 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 94.51 | |
| 1ylf_A | 149 | RRF2 family protein; structural genomics, transcri | 94.49 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 94.43 | |
| 3u1d_A | 151 | Uncharacterized protein; GNTR-superfamily, structu | 94.34 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 94.3 | |
| 4g6q_A | 182 | Putative uncharacterized protein; structural genom | 94.22 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 94.21 | |
| 4aik_A | 151 | Transcriptional regulator SLYA; transcription, tra | 94.13 | |
| 2fxa_A | 207 | Protease production regulatory protein HPR; protea | 94.08 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 94.04 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 93.98 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 93.86 | |
| 1okr_A | 123 | MECI, methicillin resistance regulatory protein ME | 93.82 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 93.81 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 93.79 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 93.75 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 93.73 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 93.7 | |
| 3k69_A | 162 | Putative transcription regulator; putative transcr | 93.63 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 93.63 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 93.63 | |
| 2k4b_A | 99 | Transcriptional regulator; DNA binding protein, wi | 93.63 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 93.63 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 93.62 | |
| 3cta_A | 230 | Riboflavin kinase; structural genomics, transferas | 93.45 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 93.21 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 93.21 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 93.19 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 93.1 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 92.83 | |
| 1hsj_A | 487 | Fusion protein consisting of staphylococcus access | 92.79 | |
| 4esf_A | 117 | PADR-like transcriptional regulator; PADR family, | 92.73 | |
| 1xd7_A | 145 | YWNA; structural genomics, protein structure initi | 92.66 | |
| 2esh_A | 118 | Conserved hypothetical protein TM0937; APC5794, st | 92.58 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 92.36 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 92.27 | |
| 4fx0_A | 148 | Probable transcriptional repressor protein; helix- | 92.26 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 91.9 | |
| 2fe3_A | 145 | Peroxide operon regulator; oxidative stress regula | 91.82 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 91.76 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 91.6 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 91.12 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 91.0 | |
| 3f8b_A | 116 | Transcriptional regulator, PADR-like family; winge | 90.95 | |
| 3l7w_A | 108 | Putative uncharacterized protein SMU.1704; PADR, t | 90.73 | |
| 3hhh_A | 116 | Transcriptional regulator, PADR family; PF03551, s | 90.59 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 90.41 | |
| 2g9w_A | 138 | Conserved hypothetical protein; DNA-binding domain | 90.4 | |
| 3eyi_A | 72 | Z-DNA-binding protein 1; alternative splicing, DNA | 90.39 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 90.27 | |
| 1sd4_A | 126 | Penicillinase repressor; BLAI, MECI, methicillin, | 90.21 | |
| 1xma_A | 145 | Predicted transcriptional regulator; southea colla | 89.91 | |
| 1fx7_A | 230 | Iron-dependent repressor IDER; DTXR, iron-dependen | 89.8 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 89.67 | |
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 89.67 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 89.52 | |
| 2vxz_A | 165 | Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py | 89.36 | |
| 3elk_A | 117 | Putative transcriptional regulator TA0346; structu | 89.36 | |
| 2qq9_A | 226 | Diphtheria toxin repressor; regulator, DTXR, helix | 89.31 | |
| 1yg2_A | 179 | Gene activator APHA; virulence factor, winged heli | 89.25 | |
| 3mwm_A | 139 | ZUR, putative metal uptake regulation protein; FUR | 89.09 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 89.02 | |
| 2xig_A | 150 | Ferric uptake regulation protein; hpfur, transcrip | 88.9 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 88.36 | |
| 1mzb_A | 136 | Ferric uptake regulation protein; ferric uptake re | 88.35 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 88.33 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 88.26 | |
| 3i71_A | 68 | Ethanolamine utilization protein EUTK; helix-turn- | 88.04 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 87.95 | |
| 2o0m_A | 345 | Transcriptional regulator, SORC family; structural | 87.8 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 87.38 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 87.19 | |
| 2p8t_A | 200 | Hypothetical protein PH0730; pyrococcus horikoshii | 87.14 | |
| 1z05_A | 429 | Transcriptional regulator, ROK family; structural | 86.37 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 85.71 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 85.56 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 85.19 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 84.79 | |
| 4esb_A | 115 | Transcriptional regulator, PADR family; DNA bindin | 84.74 | |
| 3lmm_A | 583 | Uncharacterized protein; multi-domained alpha-beta | 84.73 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 84.15 | |
| 3eyy_A | 145 | Putative iron uptake regulatory protein; NUR, nick | 83.55 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 83.21 | |
| 3maj_A | 382 | DNA processing chain A; MCSG, PSI-2, structural ge | 83.16 | |
| 3cuq_B | 218 | Vacuolar protein-sorting-associated protein 36; ES | 82.93 | |
| 1p4x_A | 250 | Staphylococcal accessory regulator A homologue; wi | 82.83 | |
| 2w57_A | 150 | Ferric uptake regulation protein; gene regulation, | 82.74 | |
| 2b0l_A | 102 | GTP-sensing transcriptional pleiotropic repressor; | 82.52 | |
| 3ri2_A | 123 | Transcriptional regulator, PADR-like family; PSI-b | 82.24 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 81.7 | |
| 3eqx_A | 373 | FIC domain containing transcriptional regulator; F | 81.46 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 81.01 | |
| 2pjp_A | 121 | Selenocysteine-specific elongation factor; SELB, p | 80.99 | |
| 2yu3_A | 95 | DNA-directed RNA polymerase III 39 kDa polypeptide | 80.18 | |
| 3qph_A | 342 | TRMB, A global transcription regulator; transcript | 80.12 |
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-45 Score=334.64 Aligned_cols=246 Identities=23% Similarity=0.374 Sum_probs=218.3
Q ss_pred hhHHHHHHHHHHhhhhHHHHHHHHHHhChhHHHHhC-CCCCHHHHHHHhCcCCCCCcchHHHHHHHHhcCCceeccccCC
Q 024046 21 EEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKA-GELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGG 99 (273)
Q Consensus 21 ~~~~~~~l~~~~~g~~~~~aL~~a~elglfd~L~~~-g~~t~~eLA~~~g~~~~~~~~~l~rlL~~L~~~gll~~~~~~~ 99 (273)
..++++.|+++++||+.+++|++|+||||||.|.+. ||+|++|||+.+|+ +++.++|+||+|++.|++++....+
T Consensus 5 e~~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~----~~~~l~rlLr~L~~~gll~~~~~~~ 80 (353)
T 4a6d_A 5 EDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRA----SAHGTELLLDICVSLKLLKVETRGG 80 (353)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTC----CHHHHHHHHHHHHHTTSEEEEEETT
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCc----CHHHHHHHHHHHHHCCCEEEeccCc
Confidence 347889999999999999999999999999999874 49999999999999 9999999999999999998642234
Q ss_pred CcceecChhchHhhcCCCCCccchhhcccCChhHHHHhhhHHHHHhcCCCcchhccC---CchhhhhhcCcchHHHHHHH
Q 024046 100 ERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHG---MHIFEYASGNPRFNETYHEA 176 (273)
Q Consensus 100 ~~~y~lt~~s~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~e~l~~g~~~~~~~~g---~~~~~~~~~~~~~~~~f~~a 176 (273)
.+.|++|+.++.++....+.+++.++.+. .+..+..|..|+++++++++++...+| .++|+++..+++....|+.+
T Consensus 81 ~~~y~~t~~s~~~l~~~~~~~~~~~~~~~-~~~~~~~~~~L~~~vr~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~f~~a 159 (353)
T 4a6d_A 81 KAFYRNTELSSDYLTTVSPTSQCSMLKYM-GRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQA 159 (353)
T ss_dssp EEEEEECHHHHHHHSTTSTTCCHHHHHHH-HHTHHHHHTTHHHHHHHTSCCHHHHHSCCCSSHHHHHTSSHHHHHHHHHH
T ss_pred cceeeCCHHHHHHhhcCCchHHHHHHHHh-CHHHHHHHHHHHHHHhcCCChhHHhcCCChHHHHHHHhhCHHHHHHHHHH
Confidence 56899999998776666556788887764 355778999999999999999988887 46899999999999999999
Q ss_pred HHhcchhhHHHHHhhcccCCCcceEEEecCCccHHHHHHHHHCCCCeEEEeechHHHHhCCC------CCCceEEEcccC
Q 024046 177 MFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPS------YAGVEHVGGNMF 250 (273)
Q Consensus 177 m~~~~~~~~~~il~~~~~~~~~~~vvDVGGG~G~~~~~l~~~~P~l~~~~~Dlp~v~~~a~~------~~ri~~~~gD~f 250 (273)
|...+...++.+++.++ |++..+|||||||+|.++..++++||+++++++|+|+|++.|++ .+||++++||||
T Consensus 160 M~~~~~~~~~~~~~~~~-~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~dlp~v~~~a~~~~~~~~~~rv~~~~gD~~ 238 (353)
T 4a6d_A 160 LQEVWSVNGRSVLTAFD-LSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFF 238 (353)
T ss_dssp HHTTHHHHHHHHHHSSC-GGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEEECHHHHHHHHHHSCC--CCSEEEEESCTT
T ss_pred HHHHHHHHHHHHHHhcC-cccCCeEEeeCCCCCHHHHHHHHhCCCceeEeccCHHHHHHHHHhhhhcccCceeeecCccc
Confidence 99998888889999998 99999999999999999999999999999999999999998764 289999999999
Q ss_pred CC-CCCCCEEEecccccccCCCC
Q 024046 251 ES-VPEGDAILMKVGNFENYQSH 272 (273)
Q Consensus 251 ~~-~p~~D~~~l~~vLHd~~~~~ 272 (273)
++ .|.+|+|++++|||||+|++
T Consensus 239 ~~~~~~~D~~~~~~vlh~~~d~~ 261 (353)
T 4a6d_A 239 KDPLPEADLYILARVLHDWADGK 261 (353)
T ss_dssp TSCCCCCSEEEEESSGGGSCHHH
T ss_pred cCCCCCceEEEeeeecccCCHHH
Confidence 85 55679999999999999874
|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* | Back alignment and structure |
|---|
| >2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 | Back alignment and structure |
|---|
| >4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} | Back alignment and structure |
|---|
| >1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* | Back alignment and structure |
|---|
| >3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 | Back alignment and structure |
|---|
| >3eyi_A Z-DNA-binding protein 1; alternative splicing, DNA-binding, polymorphism, DNA binding protein/Z-DNA complex, DNA binding protein/DNA complex; 1.45A {Homo sapiens} PDB: 2l4m_A | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A | Back alignment and structure |
|---|
| >1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} | Back alignment and structure |
|---|
| >3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... | Back alignment and structure |
|---|
| >1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 | Back alignment and structure |
|---|
| >3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
| >2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 | Back alignment and structure |
|---|
| >1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} | Back alignment and structure |
|---|
| >3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B | Back alignment and structure |
|---|
| >1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 | Back alignment and structure |
|---|
| >2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3eqx_A FIC domain containing transcriptional regulator; FIC family protein, structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.60A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qph_A TRMB, A global transcription regulator; transcriptional regulator; HET: SUC; 2.99A {Pyrococcus furiosus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 273 | ||||
| d1fp1d2 | 244 | c.66.1.12 (D:129-372) Chalcone O-methyltransferase | 7e-45 | |
| d1fp2a2 | 244 | c.66.1.12 (A:109-352) Isoflavone O-methyltransfera | 3e-42 | |
| d1kyza2 | 243 | c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli | 4e-42 | |
| d1fp1d1 | 110 | a.4.5.29 (D:19-128) Chalcone O-methyltransferase { | 1e-34 | |
| d1kyza1 | 107 | a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic | 2e-34 | |
| d1qzza2 | 256 | c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase | 7e-22 | |
| d1tw3a2 | 253 | c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf | 4e-21 | |
| d1fp2a1 | 101 | a.4.5.29 (A:8-108) Isoflavone O-methyltransferase | 1e-20 | |
| d1tw3a1 | 85 | a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransfer | 3e-15 | |
| d1qzza1 | 92 | a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase R | 4e-13 |
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Plant O-methyltransferase, C-terminal domain domain: Chalcone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Score = 149 bits (378), Expect = 7e-45
Identities = 60/144 (41%), Positives = 93/144 (64%), Gaps = 1/144 (0%)
Query: 120 SLGHFMALPLDKVFMESWLGLKDAVMEGGI-PFNRVHGMHIFEYASGNPRFNETYHEAMF 178
L F ++ W+ K+AV++ I F VHG+ +E+ + + N+ ++++M
Sbjct: 3 YLASFTTFLCYPALLQVWMNFKEAVVDEDIDLFKNVHGVTKYEFMGKDKKMNQIFNKSMV 62
Query: 179 NHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPS 238
+ M+R+LE Y GF+ + LVDVGGG G L +I SKYP IK +NFDLP V+++AP
Sbjct: 63 DVCATEMKRMLEIYTGFEGISTLVDVGGGSGRNLELIISKYPLIKGINFDLPQVIENAPP 122
Query: 239 YAGVEHVGGNMFESVPEGDAILMK 262
+G+EHVGG+MF SVP+GDA+++K
Sbjct: 123 LSGIEHVGGDMFASVPQGDAMILK 146
|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 85 | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 92 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 100.0 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 100.0 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.97 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.96 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.94 | |
| d1fp2a1 | 101 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 99.78 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.67 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.64 | |
| d1kyza1 | 107 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 99.55 | |
| d1fp1d1 | 110 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 99.5 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.19 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.11 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.08 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.05 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 98.99 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 98.9 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 98.89 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 98.87 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 98.82 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 98.81 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 98.79 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 98.78 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 98.77 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 98.71 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 98.68 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 98.68 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 98.63 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 98.59 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 98.54 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 98.53 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.53 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 98.5 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 98.47 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 98.45 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.43 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 98.39 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 98.39 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 98.32 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 98.3 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 98.29 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 98.27 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 98.26 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 98.21 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.19 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 98.18 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 98.18 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 98.17 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 98.15 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.13 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 98.13 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 98.1 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 98.05 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 98.01 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 98.0 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.99 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 97.97 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 97.94 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.9 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.89 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 97.88 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.84 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 97.83 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 97.83 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 97.78 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 97.72 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 97.68 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 97.6 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.51 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.36 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 97.35 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 97.34 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 97.33 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 97.27 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 97.27 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 97.26 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 97.24 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 97.22 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 97.21 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 97.18 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.14 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 97.1 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 96.94 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.9 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 96.9 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 96.86 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 96.85 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 96.78 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 96.7 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 96.66 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 96.65 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 96.45 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 96.44 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 96.44 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 96.37 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 96.37 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 96.36 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 96.36 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 96.33 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 96.26 | |
| d1s3ja_ | 143 | Putative transcriptional regulator YusO {Bacillus | 96.23 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 96.21 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 96.17 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 96.17 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 96.13 | |
| d1xd7a_ | 127 | Hypothetical protein ywnA {Bacillus subtilis [TaxI | 96.1 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 96.1 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 96.06 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 95.89 | |
| d1lnwa_ | 141 | MexR repressor {Pseudomonas aeruginosa [TaxId: 287 | 95.88 | |
| d2bv6a1 | 136 | Transcriptional regulator MgrA {Staphylococcus aur | 95.85 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 95.82 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 95.8 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 95.77 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 95.77 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 95.74 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 95.48 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.35 | |
| d1r7ja_ | 90 | Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu | 95.33 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 95.31 | |
| d1jgsa_ | 138 | Multiple antibiotic resistance repressor, MarR {Es | 95.18 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 95.1 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 95.07 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 95.01 | |
| d2hzta1 | 95 | Putative transcriptional regulator YtcD {Bacillus | 94.98 | |
| d1ylfa1 | 138 | Hypothetical protein BC1842 {Bacillus cereus [TaxI | 94.63 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 94.58 | |
| d2f2ea1 | 142 | Hypothetical protein PA1607 {Pseudomonas aeruginos | 94.55 | |
| d1lj9a_ | 144 | Transcriptional regulator SlyA {Enterococcus faeca | 94.53 | |
| d2fbia1 | 136 | Probable transcriptional regulator PA4135 {Pseudom | 94.36 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 94.36 | |
| d1z91a1 | 137 | Organic hydroperoxide resistance transcriptional r | 94.32 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 94.1 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 93.99 | |
| d1z7ua1 | 108 | Hypothetical protein EF0647 {Enterococcus faecalis | 93.99 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 93.94 | |
| d1xmka1 | 73 | Z-alpha domain of dsRNA-specific adenosine deamina | 93.93 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 93.9 | |
| d1yyva1 | 114 | Putative transcriptional regulator YtfH {Salmonell | 93.85 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 93.66 | |
| d3deua1 | 140 | Transcriptional regulator SlyA {Salmonella typhimu | 93.65 | |
| d2fswa1 | 102 | Hypothetical protein PG0823 {Porphyromonas gingiva | 93.63 | |
| d1j75a_ | 57 | Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | 93.39 | |
| d2fxaa1 | 162 | Protease production regulatory protein Hpr {Bacill | 93.32 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 93.1 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 93.05 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 92.79 | |
| d2gxba1 | 59 | Z-alpha domain of dsRNA-specific adenosine deamina | 92.78 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 92.73 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 92.54 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 92.36 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 91.75 | |
| d1p4xa1 | 125 | Staphylococcal accessory regulator A homolog, SarS | 91.53 | |
| d1m6ex_ | 359 | Salicylic acid carboxyl methyltransferase (SAMT) { | 91.21 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 90.91 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 90.5 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 90.25 | |
| d1dpua_ | 69 | C-terminal domain of RPA32 {Human (Homo sapiens) [ | 89.76 | |
| d2obpa1 | 81 | Putative DNA-binding protein ReutB4095 {Ralstonia | 89.75 | |
| d1q1ha_ | 88 | Transcription factor E/IIe-alpha, N-terminal domai | 89.58 | |
| d1sfua_ | 70 | 34L {Yaba-like disease virus, YLDV [TaxId: 132475] | 88.68 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 88.49 | |
| d2p8ta1 | 69 | Hypothetical protein PH0730 {Pyrococcus horikoshii | 88.16 | |
| d1y0ua_ | 89 | Putative arsenical resistance operon repressor AF0 | 87.69 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 86.9 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 85.55 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 84.89 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 84.89 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 84.88 | |
| d1okra_ | 120 | Methicillin resistance regulatory protein MecI {St | 84.62 | |
| d1s6la1 | 60 | Alkylmercury lyase MerB {Escherichia coli [TaxId: | 84.45 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 83.59 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 82.68 | |
| d2g9wa1 | 122 | Hypothetical protein Rv1846c {Mycobacterium tuberc | 82.57 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 82.28 | |
| d1stza1 | 87 | Heat-inducible transcription repressor HrcA, N-ter | 81.91 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 81.38 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 81.0 |
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Plant O-methyltransferase, C-terminal domain domain: Chalcone O-methyltransferase species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=100.00 E-value=2.5e-34 Score=245.53 Aligned_cols=154 Identities=38% Similarity=0.764 Sum_probs=132.9
Q ss_pred CccchhhcccCChhHHHHhhhHHHHHhcCC-CcchhccCCchhhhhhcCcchHHHHHHHHHhcchhhHHHHHhhcccCCC
Q 024046 119 ASLGHFMALPLDKVFMESWLGLKDAVMEGG-IPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQN 197 (273)
Q Consensus 119 ~~~~~~~~~~~~~~~~~~~~~L~e~l~~g~-~~~~~~~g~~~~~~~~~~~~~~~~f~~am~~~~~~~~~~il~~~~~~~~ 197 (273)
.|+++++.++++|.+++.|.+|++++++++ ++|+.++|.++|+|+.+||+..+.|+.+|.+.+...++.+++.++.|++
T Consensus 2 g~l~~~~~~~~~p~~~~~w~~l~~~v~~g~~~~f~~~~G~~~~e~l~~~p~~~~~F~~aM~~~s~~~~~~l~~~~~~f~~ 81 (244)
T d1fp1d2 2 GYLASFTTFLCYPALLQVWMNFKEAVVDEDIDLFKNVHGVTKYEFMGKDKKMNQIFNKSMVDVCATEMKRMLEIYTGFEG 81 (244)
T ss_dssp CCCTHHHHHHTCHHHHHHHTTHHHHHHSCC--------------CCSSCHHHHHHHHHHHHHHHHHHHHHHHHHCCTTTT
T ss_pred ccHHHHHHHHhCHHHHHHHHHHHHHHhcCCCCHhHHhcCCCHHHHHhhCHHHHHHHHHHHHHHHHHHHHHHHHhcccccC
Confidence 378888988889999999999999999876 5699999999999999999999999999999998888999999987889
Q ss_pred cceEEEecCCccHHHHHHHHHCCCCeEEEeechHHHHhCCCCCCceEEEcccCCCCCCCCEEEecccccccCCCC
Q 024046 198 VERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKVGNFENYQSH 272 (273)
Q Consensus 198 ~~~vvDVGGG~G~~~~~l~~~~P~l~~~~~Dlp~v~~~a~~~~ri~~~~gD~f~~~p~~D~~~l~~vLHd~~~~~ 272 (273)
..+|||||||+|.++++++++||+++++++|+|+|++.+...+||++++||||+++|.+|+|++++|||||+||+
T Consensus 82 ~~~vlDiGGG~G~~~~~l~~~~P~l~~~v~Dlp~vi~~~~~~~ri~~~~gd~~~~~p~~D~~~l~~vLh~~~de~ 156 (244)
T d1fp1d2 82 ISTLVDVGGGSGRNLELIISKYPLIKGINFDLPQVIENAPPLSGIEHVGGDMFASVPQGDAMILKAVCHNWSDEK 156 (244)
T ss_dssp CSEEEEETCTTSHHHHHHHHHCTTCEEEEEECHHHHTTCCCCTTEEEEECCTTTCCCCEEEEEEESSGGGSCHHH
T ss_pred CcEEEEecCCCcHHHHHHHHHCCCCeEEEecchhhhhccCCCCCeEEecCCcccccccceEEEEehhhhhCCHHH
Confidence 999999999999999999999999999999999999998888999999999999999889999999999999874
|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y0ua_ a.4.5.5 (A:) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|