Citrus Sinensis ID: 024069

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---

MDAVKANLGGKKVIFCGLIQYLNLFVTGTQKLWRSLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY

cccccccccccCEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc

****K**LGGKKVIFCGLIQYLNLFVTGTQKLWRSLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Amino acid permease 4	Amino acid-proton symporter. Stereospecific transporter with a broad specificity for neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine.	probable	Q9FN04

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 29-96
View the alignment between query and template
View the model in PyMOL