Citrus Sinensis ID: 024076

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV
ccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccHHHcccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccEEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccc
ccEEEEcccccHccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccHHHHHHcccEEEEEEccccccccccccHHHHHHHHccccccccccccccccccEEEEEEccccccEEEEccccccEcHHHccHHHHHcccccccHHHHHHHcccccccccccHHcc
msfvfrgsradletgfpgfiperrtvrihagrpvnsnSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGhtelrlqmppaiafASRGRLQGLRLQLALLDREFDELDYETLRaldadnvptaasmseeeintlpvhkykvsgsqsgassmqlgsssspaekKLETSIsvgnlktedeltCTVCleqvnvgeivrslpclhqfhancidpwlrqqgtcpvcklragsgwhetrqvemdasymv
msfvfrgsradletgfpgfipeRRTVRihagrpvnsNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASsmqlgsssspaeKKLETSISvgnlktedelTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLragsgwhetrqvemdasymv
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCqqlhaqaqahaVASGLLGHTELRLQMPPAIAFASrgrlqglrlqlallDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVsgsqsgassmqlgssssPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV
***********LETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALD********************************************************LKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWH*************
*SFV*R*SRADLETGFPGFIP*****************LAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMY**********************TELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDY************************LPV***************************************EDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVC**********************
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYK************************ETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV
*SFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVP*AASMSEEEINTLPVHKYKVSGS********************************DELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWH*************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSNFLLWIVLGIFLLATSLRMYATCQQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGRLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query273 2.2.26 [Sep-21-2011]
Q9M2S6273 E3 ubiquitin-protein liga yes no 0.992 0.992 0.72 1e-108
Q8VEM1419 E3 ubiquitin-protein liga yes no 0.263 0.171 0.418 5e-12
Q6Y290419 E3 ubiquitin-protein liga yes no 0.263 0.171 0.418 6e-12
Q86XS8419 E3 ubiquitin-protein liga yes no 0.263 0.171 0.418 7e-12
Q5DTZ6437 RING finger protein 150 O no no 0.263 0.164 0.418 2e-11
Q9ULK6438 RING finger protein 150 O no no 0.263 0.164 0.418 2e-11
Q06003461 Protein goliath OS=Drosop no no 0.263 0.156 0.415 8e-11
Q8NC42400 E3 ubiquitin-protein liga no no 0.369 0.252 0.355 9e-11
Q566M8419 RING finger protein 150 O no no 0.263 0.171 0.405 1e-10
Q7TPV21204 E3 ubiquitin-protein liga no no 0.406 0.092 0.308 2e-10
>sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  392 bits (1006), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/275 (72%), Positives = 222/275 (80%), Gaps = 4/275 (1%)

Query: 1   MSFVFRGSRADLETGFPG-FIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSS 59
           MSFVFRGSR DLE+GF G F+PERR +R+H  RPVNSNSLAFLVTVLLLFMILNSHQM  
Sbjct: 1   MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query: 60  NFLLWIVLGIFLLATSLRMYATC-QQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRG 118
           NFLLW+VLG+FL+AT+LRMYATC Q         A ASGL  HTELRL +PP+IA A+RG
Sbjct: 61  NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query: 119 RLQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGA 178
           RLQGLRLQLALLDREFD+LDYETLRALD+DNV T  SMSEEEIN LPVHKYKV   ++G 
Sbjct: 121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVST-TSMSEEEINALPVHKYKVLDPENGC 179

Query: 179 SSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCI 238
           S  +  S+SS AEK L+ S +     TEDELTC+VCLEQV VGEIVR+LPCLHQFHA CI
Sbjct: 180 SLAKQASTSSSAEKMLD-SANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCI 238

Query: 239 DPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV 273
           DPWLRQQGTCPVCK RA SGW E  +++ DAS MV
Sbjct: 239 DPWLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV 273
E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 Back     alignment and function description
>sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 Back     alignment and function description
>sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 Back     alignment and function description
>sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 Back     alignment and function description
>sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 Back     alignment and function description
>sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 Back     alignment and function description
>sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 Back     alignment and function description
>sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 Back     alignment and function description
>sp|Q7TPV2|DZIP3_MOUSE E3 ubiquitin-protein ligase DZIP3 OS=Mus musculus GN=Dzip3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
359486786275 PREDICTED: E3 ubiquitin-protein ligase S 1.0 0.992 0.774 1e-114
224104393275 predicted protein [Populus trichocarpa] 0.996 0.989 0.739 1e-112
255581543276 protein binding protein, putative [Ricin 1.0 0.989 0.764 1e-112
449441410275 PREDICTED: E3 ubiquitin-protein ligase S 0.996 0.989 0.775 1e-111
307136233275 protein binding protein [Cucumis melo su 0.996 0.989 0.775 1e-111
147779997262 hypothetical protein VITISV_012400 [Viti 0.956 0.996 0.762 1e-110
359807355274 uncharacterized protein LOC100777936 [Gl 0.959 0.956 0.803 1e-110
224109496276 predicted protein [Populus trichocarpa] 1.0 0.989 0.778 1e-110
363807434274 uncharacterized protein LOC100816448 [Gl 0.959 0.956 0.795 1e-109
297820308272 zinc finger family protein [Arabidopsis 0.992 0.996 0.722 1e-109
>gi|359486786|ref|XP_002283148.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Vitis vinifera] gi|296086209|emb|CBI31650.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/275 (77%), Positives = 237/275 (86%), Gaps = 2/275 (0%)

Query: 1   MSFVFRGSRADLETGFPGFIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSSN 60
           MSFVFRGSRAD+E+GFPGFIPERR VR+HA RPVN+NSLAFLVTVLLLFMILNSHQMS N
Sbjct: 1   MSFVFRGSRADIESGFPGFIPERRAVRVHAARPVNTNSLAFLVTVLLLFMILNSHQMSPN 60

Query: 61  FLLWIVLGIFLLATSLRMYATC-QQLHAQAQAHAVASGLLGHTELRLQMPPAIAFASRGR 119
           FL+W+VLGIFL+AT+LRMYATC Q         A ASGLLGHTELRL MPP+IA A+RGR
Sbjct: 61  FLIWLVLGIFLMATTLRMYATCQQLQAQAQAHAAAASGLLGHTELRLHMPPSIALATRGR 120

Query: 120 LQGLRLQLALLDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVSGSQSGAS 179
           LQGLRLQLALLDREFD+LDYETLRALD++NVPT  SMSEEEIN LPVHKYKV+G+Q G S
Sbjct: 121 LQGLRLQLALLDREFDDLDYETLRALDSENVPTTPSMSEEEINALPVHKYKVAGTQGGGS 180

Query: 180 SMQLGSSSSPAEKKLETSISVGNLKT-EDELTCTVCLEQVNVGEIVRSLPCLHQFHANCI 238
           SMQ GSSS+ AEKK + + +V + K  +DELTC+VCLEQVNVGE++RSLPCLHQFHANCI
Sbjct: 181 SMQQGSSSASAEKKQDINNAVASTKAPDDELTCSVCLEQVNVGELIRSLPCLHQFHANCI 240

Query: 239 DPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV 273
           DPWLRQQGTCPVCK RA  GW E  Q  MDASYMV
Sbjct: 241 DPWLRQQGTCPVCKFRAAPGWQENGQGGMDASYMV 275

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104393|ref|XP_002313422.1| predicted protein [Populus trichocarpa] gi|222849830|gb|EEE87377.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581543|ref|XP_002531577.1| protein binding protein, putative [Ricinus communis] gi|223528807|gb|EEF30813.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449441410|ref|XP_004138475.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136233|gb|ADN34069.1| protein binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|147779997|emb|CAN60068.1| hypothetical protein VITISV_012400 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359807355|ref|NP_001241380.1| uncharacterized protein LOC100777936 [Glycine max] gi|255645784|gb|ACU23384.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224109496|ref|XP_002315216.1| predicted protein [Populus trichocarpa] gi|222864256|gb|EEF01387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363807434|ref|NP_001242131.1| uncharacterized protein LOC100816448 [Glycine max] gi|255641194|gb|ACU20874.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297820308|ref|XP_002878037.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323875|gb|EFH54296.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
TAIR|locus:2100021273 SDIR1 "SALT- AND DROUGHT-INDUC 0.992 0.992 0.643 4.1e-88
TAIR|locus:2010582634 AT1G04790 [Arabidopsis thalian 0.157 0.067 0.581 4.5e-20
DICTYBASE|DDB_G0282479320 DDB_G0282479 "E3 ubiquitin-pro 0.183 0.156 0.4 1.4e-16
ZFIN|ZDB-GENE-060503-608301 si:ch211-81a5.1 "si:ch211-81a5 0.234 0.212 0.492 3.6e-14
ZFIN|ZDB-GENE-050522-525392 zgc:113271 "zgc:113271" [Danio 0.234 0.163 0.454 2.3e-13
ZFIN|ZDB-GENE-060526-65378 si:ch211-188g24.2 "si:ch211-18 0.179 0.129 0.551 4e-12
ZFIN|ZDB-GENE-060213-1418 rnf150a "ring finger protein 1 0.234 0.153 0.439 5.1e-12
DICTYBASE|DDB_G0293132766 DDB_G0293132 "E3 ubiquitin-pro 0.402 0.143 0.330 7e-12
UNIPROTKB|K7GLM9238 LOC100519887 "Uncharacterized 0.234 0.268 0.439 7.1e-12
TAIR|locus:2824666201 AT1G35625 "AT1G35625" [Arabido 0.245 0.333 0.420 1.3e-11
TAIR|locus:2100021 SDIR1 "SALT- AND DROUGHT-INDUCED RING FINGER1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 880 (314.8 bits), Expect = 4.1e-88, P = 4.1e-88
 Identities = 177/275 (64%), Positives = 197/275 (71%)

Query:     1 MSFVFRGSRADLETGFPG-FIPERRTVRIHAGRPVNSNSLAFLVTVLLLFMILNSHQMSS 59
             MSFVFRGSR DLE+GF G F+PERR +R+H  RPVNSNSLAFLVTVLLLFMILNSHQM  
Sbjct:     1 MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP 60

Query:    60 NFLLWIVLGIFLLATSLRMYATCXXXXXXXXX-XXVASGLLGHTELRLQMPPAIAFASXX 118
             NFLLW+VLG+FL+AT+LRMYATC             ASGL  HTELRL +PP+IA A+  
Sbjct:    61 NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG 120

Query:   119 XXXXXXXXXXXXDREFDELDYETLRALDADNVPTAASMSEEEINTLPVHKYKVXXXXXXX 178
                         DREFD+LDYETLRALD+DNV T  SMSEEEIN LPVHKYKV       
Sbjct:   121 RLQGLRLQLALLDREFDDLDYETLRALDSDNVSTT-SMSEEEINALPVHKYKVLDPENGC 179

Query:   179 XXXXXXXXXXPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFHANCI 238
                        AEK L+ S +     TEDELTC+VCLEQV VGEIVR+LPCLHQFHA CI
Sbjct:   180 SLAKQASTSSSAEKMLD-SANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCI 238

Query:   239 DPWLRQQGTCPVCKLRAGSGWHETRQVEMDASYMV 273
             DPWLRQQGTCPVCK RA SGW E  +++ DAS MV
Sbjct:   239 DPWLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV 273
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009789 "positive regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006301 "postreplication repair" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
TAIR|locus:2010582 AT1G04790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282479 DDB_G0282479 "E3 ubiquitin-protein ligase DMA2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-608 si:ch211-81a5.1 "si:ch211-81a5.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-525 zgc:113271 "zgc:113271" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-65 si:ch211-188g24.2 "si:ch211-188g24.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060213-1 rnf150a "ring finger protein 150a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293132 DDB_G0293132 "E3 ubiquitin-protein ligase Arkadia" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLM9 LOC100519887 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2824666 AT1G35625 "AT1G35625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2S6SDIR1_ARATH6, ., 3, ., 2, ., -0.720.99260.9926yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-16
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-11
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-09
smart0018440 smart00184, RING, Ring finger 3e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 5e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-07
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 4e-07
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 2e-06
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 3e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 5e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 70.9 bits (174), Expect = 2e-16
 Identities = 21/43 (48%), Positives = 27/43 (62%)

Query: 210 TCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCK 252
            C +CL++   GE V  LPC H FH  C+D WLR   TCP+C+
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 273
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.61
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.53
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.27
PHA02929238 N1R/p28-like protein; Provisional 99.23
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.15
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.14
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.14
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.11
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.01
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.0
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.98
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.96
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.95
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.85
PHA02926242 zinc finger-like protein; Provisional 98.82
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.79
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.78
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.72
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.72
PF1463444 zf-RING_5: zinc-RING finger domain 98.71
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.68
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.65
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.45
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.44
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.38
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.33
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.31
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.28
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.25
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.22
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.18
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.17
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.14
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.14
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.13
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.13
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.02
COG52191525 Uncharacterized conserved protein, contains RING Z 97.96
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.86
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.78
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.72
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.68
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.57
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.48
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.42
KOG1941518 consensus Acetylcholine receptor-associated protei 97.33
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.22
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.09
KOG2660 331 consensus Locus-specific chromosome binding protei 97.01
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.91
COG5152259 Uncharacterized conserved protein, contains RING a 96.89
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.72
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.72
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.45
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.18
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.12
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.07
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.98
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.96
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.71
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.56
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.47
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.35
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.34
PHA03096284 p28-like protein; Provisional 95.3
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.24
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
PHA02862156 5L protein; Provisional 95.14
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.1
COG5222427 Uncharacterized conserved protein, contains RING Z 95.1
PHA02825162 LAP/PHD finger-like protein; Provisional 95.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.55
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.55
KOG4739 233 consensus Uncharacterized protein involved in syna 94.52
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.42
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.02
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 93.8
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.92
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.84
KOG0298 1394 consensus DEAD box-containing helicase-like transc 92.72
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.71
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 92.69
KOG1940276 consensus Zn-finger protein [General function pred 92.59
PF04641260 Rtf2: Rtf2 RING-finger 92.03
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.4
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.07
KOG4367 699 consensus Predicted Zn-finger protein [Function un 91.03
KOG3002 299 consensus Zn finger protein [General function pred 90.73
PF10272358 Tmpp129: Putative transmembrane protein precursor; 90.33
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.26
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.89
KOG0825 1134 consensus PHD Zn-finger protein [General function 88.18
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 88.0
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 87.75
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.29
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 87.08
KOG3053 293 consensus Uncharacterized conserved protein [Funct 87.02
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 86.81
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 85.76
KOG0269839 consensus WD40 repeat-containing protein [Function 85.25
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 85.04
KOG1609 323 consensus Protein involved in mRNA turnover and st 84.42
KOG1829580 consensus Uncharacterized conserved protein, conta 83.83
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 81.88
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.61  E-value=5.5e-16  Score=143.45  Aligned_cols=82  Identities=38%  Similarity=0.799  Sum_probs=67.4

Q ss_pred             CCCHHHHhhCCceeeeccCCCCCCCcccCCCCCChhhhhhhcccccCCCCCCCCccccccccccccCCeeEEeCCCCccC
Q 024076          155 SMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPCLHQFH  234 (273)
Q Consensus       155 ~ls~~~I~~Lp~~~~k~~~~~~g~~~~~~~ss~s~~~~~~~~~~~~~~~~~~~~~~C~ICle~~~~~~~v~~lpC~H~FH  234 (273)
                      .+.+..+.++|..+|+.....                              ....+|+||+|+|..||.++.|||+|.||
T Consensus       206 r~~k~~l~~~p~~~f~~~~~~------------------------------~~~~~CaIClEdY~~GdklRiLPC~H~FH  255 (348)
T KOG4628|consen  206 RLIKRLLKKLPVRTFTKGDDE------------------------------DATDTCAICLEDYEKGDKLRILPCSHKFH  255 (348)
T ss_pred             hhHHHHHhhCCcEEecccccc------------------------------CCCceEEEeecccccCCeeeEecCCCchh
Confidence            467788999999999755431                              11158999999999999999999999999


Q ss_pred             hhhHHHHHhcCCC-cccccccccCCCCCCcccc
Q 024076          235 ANCIDPWLRQQGT-CPVCKLRAGSGWHETRQVE  266 (273)
Q Consensus       235 ~~CI~~WL~~~~~-CP~CR~~v~~~~~~~~~~~  266 (273)
                      ..||++||.++.+ ||+||..+..........|
T Consensus       256 ~~CIDpWL~~~r~~CPvCK~di~~~~~~~~~~e  288 (348)
T KOG4628|consen  256 VNCIDPWLTQTRTFCPVCKRDIRTDSGSEPVSE  288 (348)
T ss_pred             hccchhhHhhcCccCCCCCCcCCCCCCCCCccC
Confidence            9999999998755 9999998877766655554

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-09
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-08
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 3e-08
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-07
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 3e-05
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 5e-05
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 2e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 4/58 (6%)
Query: 199 SVGNLKTEDE----LTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCK 252
           S G+  TE+     L C VC E   +GE VR LPC H FH +CI PWL Q  +CPVC+
Sbjct: 2   SSGSSGTEEHVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCR 59
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-24
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 5e-24
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 6e-24
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-23
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-21
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-17
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 7e-16
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-13
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 3e-10
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-10
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-10
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 1e-09
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-09
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 4e-09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-08
1z6u_A150 NP95-like ring finger protein isoform B; structura 7e-08
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 6e-07
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 4e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 8e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-05
3nw0_A238 Non-structural maintenance of chromosomes element 2e-05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 4e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 6e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 6e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 7e-05
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 7e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 8e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 9e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-04
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
 Score = 92.4 bits (230), Expect = 2e-24
 Identities = 22/47 (46%), Positives = 29/47 (61%)

Query: 206 EDELTCTVCLEQVNVGEIVRSLPCLHQFHANCIDPWLRQQGTCPVCK 252
           + E  CT+CL  +  GE VR LPC+H FH  C+D WL     CP+C+
Sbjct: 12  DTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICR 58
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.68
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.57
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.55
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.55
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.54
2ect_A78 Ring finger protein 126; metal binding protein, st 99.53
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.52
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.44
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.44
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.42
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.4
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.38
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.37
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.37
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.36
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.34
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.32
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.32
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.31
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.31
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.3
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.3
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.28
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.27
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.25
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.23
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.22
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.2
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.2
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.2
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.19
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.18
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.18
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.17
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.15
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.09
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.08
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.07
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.07
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.02
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.01
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.98
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.95
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.95
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.95
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.9
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.88
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.84
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.81
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.78
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.78
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.77
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.74
2ea5_A68 Cell growth regulator with ring finger domain prot 98.66
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.64
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.63
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.6
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.58
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.53
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.42
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.4
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.01
3nw0_A238 Non-structural maintenance of chromosomes element 97.82
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.28
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.53
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.41
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.96
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 90.58
1weu_A91 Inhibitor of growth family, member 4; structural g 89.33
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 88.55
1we9_A64 PHD finger family protein; structural genomics, PH 88.13
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 87.98
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 87.92
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 87.44
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 87.35
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.25
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 85.38
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.15
2k16_A75 Transcription initiation factor TFIID subunit 3; p 84.82
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 84.67
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 84.2
1wem_A76 Death associated transcription factor 1; structura 83.14
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 82.62
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 82.42
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 81.03
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 80.82
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 80.75
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.68  E-value=5.7e-17  Score=122.69  Aligned_cols=79  Identities=30%  Similarity=0.701  Sum_probs=66.2

Q ss_pred             CCCCCCCCHHHHhhCCceeeeccCCCCCCCcccCCCCCChhhhhhhcccccCCCCCCCCccccccccccccCCeeEEeCC
Q 024076          150 VPTAASMSEEEINTLPVHKYKVSGSQSGASSMQLGSSSSPAEKKLETSISVGNLKTEDELTCTVCLEQVNVGEIVRSLPC  229 (273)
Q Consensus       150 ~~~~~~ls~~~I~~Lp~~~~k~~~~~~g~~~~~~~ss~s~~~~~~~~~~~~~~~~~~~~~~C~ICle~~~~~~~v~~lpC  229 (273)
                      .....+++++.|+.||...+.....                             ..+++..|+||++.+..++.+..+||
T Consensus        11 ~~~~~~~s~~~i~~lp~~~~~~~~~-----------------------------~~~~~~~C~IC~~~~~~~~~~~~l~C   61 (91)
T 2l0b_A           11 MVANPPASKESIDALPEILVTEDHG-----------------------------AVGQEMCCPICCSEYVKGDVATELPC   61 (91)
T ss_dssp             SSCCCCCCHHHHHTSCEEECCTTCS-----------------------------SSSSCSEETTTTEECCTTCEEEEETT
T ss_pred             CcCCCCCCHHHHHhCCCeeeccccc-----------------------------ccCCCCCCcccChhhcCCCcEEecCC
Confidence            3456789999999999887653221                             11356689999999999888899999


Q ss_pred             CCccChhhHHHHHhcCCCcccccccccC
Q 024076          230 LHQFHANCIDPWLRQQGTCPVCKLRAGS  257 (273)
Q Consensus       230 ~H~FH~~CI~~WL~~~~~CP~CR~~v~~  257 (273)
                      ||.||..||.+|++.+.+||+||..+..
T Consensus        62 ~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           62 HHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             TEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            9999999999999999999999998764
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 273
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-18
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-13
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 6e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 9e-11
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 9e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-10
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 4e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-09
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 9e-08
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 3e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.004
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 74.1 bits (182), Expect = 4e-18
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 206 EDELTCTVCLEQVNVGEIVRSLP-CLHQFHANCIDPWLRQQGTCPVCK 252
           +D + C VCL ++  GE  R LP C H FHA C+D WL    TCP+C+
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.65
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.54
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.53
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.4
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.38
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.36
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.23
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.22
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.19
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.14
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.02
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.02
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.01
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.82
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.43
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.78
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.21
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.23
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 87.3
d1wema_76 Death associated transcription factor 1, Datf1 (DI 82.88
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.84
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 80.97
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 80.02
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.65  E-value=2.1e-17  Score=112.40  Aligned_cols=50  Identities=48%  Similarity=1.077  Sum_probs=45.5

Q ss_pred             CCccccccccccccCCeeEEeC-CCCccChhhHHHHHhcCCCccccccccc
Q 024076          207 DELTCTVCLEQVNVGEIVRSLP-CLHQFHANCIDPWLRQQGTCPVCKLRAG  256 (273)
Q Consensus       207 ~~~~C~ICle~~~~~~~v~~lp-C~H~FH~~CI~~WL~~~~~CP~CR~~v~  256 (273)
                      ++.+|+||+++|..++.+..++ |+|.||..||.+|++.+++||+||+++.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            5567999999999999888876 9999999999999999999999998763
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure