Citrus Sinensis ID: 024092

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MLLICLGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKSEEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPATDKGGEKKEKEAAAAGGGDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYANQGYPPQMHHAPPMYHAPQMFSDENPNACSVM

cccccccccEEEEEccccEEEEEEEccHHHHHHHHHHHHcccccccccccccccccccccccHHccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccEEEcccEEEEEEccccEEEEEEEccHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEEcHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcc

MLLICLGVVdvktdcgankvtvtgkvepAKLKERLEaktkkkvdlvspqpkkdagggekkseeksekkpddkkseekkppkesTVVLKIRLHCEGCISKIKKIIYKtkgvdnvtidggkdlvtvkgtmDVKELVPYLKEKLKRNvevvpakkddgekkenkdadkggdkkakeaapatdkggekkekeaaaagggdggkvEVHKMeyygypyppapsywydnhvygqsypmenqHQVVYanqgyppqmhhappmyhapqmfsdenpnacsvm

MLLICLGVvdvktdcgankvtvtgkvepaklkerleaktkkkvdlvspqpkkdagggekkseeksekkpddkkseekkppkestvvlkirlHCEGCISKIkkiiyktkgvdnvtidggkdlvtvkgtmdVKELVpylkeklkrnvevvpakkddgekkenkdadkggdkkakeaapatdkggekkekeaaaagggdggkVEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYANQGYPPQMHHAPPMYHAPQMFSDENPNACSVM

MLLICLGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPkkdagggekkseeksekkpddkkseekkppkeSTVVLKIRLHCEGCiskikkiiyktkGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVPakkddgekkenkdadkggdkkakeaaPATdkggekkekeaaaagggdggkvevHKMEyygypyppapsywyDNHVYGQSYPMENQHQVVYANQGYPPQMHHAPPMYHAPQMFSDENPNACSVM

*LLICLGVVDVKTDCGANKVTVTG***********************************************************TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKR********************************************************VEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYAN*******************************

MLLICLGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKT*******************************************STVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVV*****************************************************VHKMEYYGYPYPP**********Y****P*****************MHHAPPMYHAPQMFSDENPNACSVM

MLLICLGVVDVKTDCGANKVTVTGKVEPAKLKERLEAK*********************************************TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVPAK**********************************************GKVEVHKMEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYANQGYPPQMHHAPPMYHAPQMFSDENPNACSVM

MLLICLGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQ*****************************PPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVPAK*****************************************************MEYYGYPYPPAPSYWYDNHVYGQSYPMENQHQVVYANQGYPPQMHHAPPMYHAPQMFSDENPNACSVM

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		272
356505250		329	PREDICTED: uncharacterized protein LOC10	0.893	0.738	0.496	2e-55
356570770		335	PREDICTED: uncharacterized protein LOC10	0.915	0.743	0.5	7e-53
224140221		330	predicted protein [Populus trichocarpa]	0.944	0.778	0.536	2e-52
413968366		324	hypothetical protein [Phaseolus vulgaris	0.889	0.746	0.462	8e-52
255556920		345	metal ion binding protein, putative [Ric	0.908	0.715	0.501	4e-51
18404283		386	heavy-metal-associated domain-containing	0.952	0.670	0.484	4e-49
449451042		324	PREDICTED: uncharacterized protein LOC10	0.937	0.787	0.441	8e-49
388495726		343	unknown [Lotus japonicus]	0.930	0.737	0.481	1e-47
297823503		388	hypothetical protein ARALYDRAFT_482676 [	0.955	0.670	0.476	3e-47
449482425		326	PREDICTED: uncharacterized protein LOC10	0.926	0.773	0.472	1e-46

>gi\|356505250\|ref\|XP_003521405.1\| PREDICTED: uncharacterized protein LOC100792662 [Glycine max]	Back alignment and taxonomy information

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 181/300 (60%), Gaps = 57/300 (19%)

Query: 7   GVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSE 66
           GV DVKTD  + K+TV GKV+PAK++++L  KTKKKV+L+SPQPKKD+ G +   E+KSE
Sbjct: 53  GVEDVKTDLSSKKLTVIGKVDPAKVRDKLAEKTKKKVELISPQPKKDSAGDKPPEEKKSE 112

Query: 67  KKPDDKKSEEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKG 126
           +K  + K  E+K PKESTVVLKIRLHCEGCI KI+KII KTKGV++V I+GGKDLV+VKG
Sbjct: 113 EKKPEDKKAEEKTPKESTVVLKIRLHCEGCIQKIRKIILKTKGVESVNIEGGKDLVSVKG 172

Query: 127 TMDVKELVPYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPATDKGGEKKE 186
           TMDVKE+VPYL EKLKRNVEVVP KK+ G                       DK    K+
Sbjct: 173 TMDVKEIVPYLNEKLKRNVEVVPPKKEGG-----------------------DKKENNKK 209

Query: 187 KEAAAAGGGDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYG------------QSYPMENQ 234
           +     G     KVEV+KME+YGY YP    YW+ +  Y              SY +E Q
Sbjct: 210 EGGGGGGAEGAAKVEVNKMEHYGYAYPAPHMYWHGHGGYAPGESSSSSSSSNNSYEVEVQ 269

Query: 235 HQVVYANQGY----------------------PPQMHHAPPMYHAPQMFSDENPNACSVM 272
               Y+NQGY                      PP   +  P +  PQMFSDENPNACSVM
Sbjct: 270 SGYSYSNQGYDGNYVNYPYQHGYNDNYMAMAQPPPPFYLNPHHPPPQMFSDENPNACSVM 329

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356570770\|ref\|XP_003553557.1\| PREDICTED: uncharacterized protein LOC100795652 [Glycine max]	Back alignment and taxonomy information

>gi\|224140221\|ref\|XP_002323483.1\| predicted protein [Populus trichocarpa] gi\|222868113\|gb\|EEF05244.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|413968366\|gb\|AFW90521.1\| hypothetical protein [Phaseolus vulgaris]	Back alignment and taxonomy information

>gi\|255556920\|ref\|XP_002519493.1\| metal ion binding protein, putative [Ricinus communis] gi\|223541356\|gb\|EEF42907.1\| metal ion binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|18404283\|ref\|NP_565855.1\| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi\|20197942\|gb\|AAD31580.2\| putative farnesylated protein [Arabidopsis thaliana] gi\|330254231\|gb\|AEC09325.1\| heavy-metal-associated domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449451042\|ref\|XP_004143271.1\| PREDICTED: uncharacterized protein LOC101221463 isoform 2 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|388495726\|gb\|AFK35929.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|297823503\|ref\|XP_002879634.1\| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata] gi\|297325473\|gb\|EFH55893.1\| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449482425\|ref\|XP_004156278.1\| PREDICTED: uncharacterized protein LOC101231228 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		272
TAIR\|locus:2057951		386	AT2G36950 [Arabidopsis thalian	0.525	0.370	0.458	4e-37
TAIR\|locus:2142614		392	AT5G03380 [Arabidopsis thalian	0.246	0.170	0.611	6.8e-33
TAIR\|locus:2046183		245	AT2G28090 [Arabidopsis thalian	0.488	0.542	0.354	5.8e-20
TAIR\|locus:2018768		287	AT1G29000 [Arabidopsis thalian	0.525	0.498	0.265	2.2e-18
TAIR\|locus:2163300		290	AT5G50740 [Arabidopsis thalian	0.161	0.151	0.488	9e-18
TAIR\|locus:2075497		246	AT3G02960 "AT3G02960" [Arabido	0.238	0.264	0.338	1.3e-17
TAIR\|locus:2167366		355	FP3 "farnesylated protein 3" [	0.161	0.123	0.488	3.6e-17
TAIR\|locus:2153969		319	AT5G24580 "AT5G24580" [Arabido	0.246	0.210	0.298	9.1e-14
TAIR\|locus:2096204		577	AT3G05220 [Arabidopsis thalian	0.172	0.081	0.407	1.6e-06
TAIR\|locus:2133544		150	AT4G08570 "AT4G08570" [Arabido	0.238	0.433	0.343	2.1e-06

TAIR\|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 291 (107.5 bits), Expect = 4.0e-37, Sum P(2) = 4.0e-37
 Identities = 67/146 (45%), Positives = 79/146 (54%)

Query:     7 GVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPXXXXXXXXXXXXXXXX 66
             GV DV  D G NK+ V GK++P KL+E+LE KTK+KV L +P P                
Sbjct:    76 GVKDVTADTGGNKLLVVGKIDPVKLQEKLEEKTKRKVVLANPPPKVEGPVAAAVGEKKAD 135

Query:    67 XXXXXXX--XXXXXXXXXSTVVLKIRLHCEGCXXXXXXXXXXXXGVDNVTIDGGKDLVTV 124
                               S V LKIRLHCEGC            GV+ V IDG KD+VTV
Sbjct:   136 GGDKEAAPPAPAPAAPKESVVPLKIRLHCEGCIQKIKKIILKIKGVETVAIDGAKDVVTV 195

Query:   125 KGTMDVKELVPYLKEKLKRNVE-VVP 149
             KGT+DVKELVP L +KLKR VE +VP
Sbjct:   196 KGTIDVKELVPLLTKKLKRTVEPLVP 221

GO:0005737 "cytoplasm" evidence=ISM

GO:0030001 "metal ion transport" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA;ISS

GO:0005507 "copper ion binding" evidence=IDA

GO:0009407 "toxin catabolic process" evidence=RCA

GO:0010583 "response to cyclopentenone" evidence=RCA

GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA

TAIR\|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		272
pfam00403		62	pfam00403, HMA, Heavy-metal-associated domain	5e-08
cd00371		63	cd00371, HMA, Heavy-metal-associated domain (HMA)	0.002

>gnl\|CDD\|215902 pfam00403, HMA, Heavy-metal-associated domain	Back alignment and domain information

 Score = 48.4 bits (116), Expect = 5e-08
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 85  VVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRN 144
            +    + C GC  K++K + K  GV +V++D     VTV G  D  +L     EKLK+ 
Sbjct: 1   TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKL-----EKLKKA 55

Query: 145 VE 146
           +E
Sbjct: 56  IE 57

Length = 62

>gnl\|CDD\|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		272
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	99.44
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	99.32
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	99.3
KOG4656		247	consensus Copper chaperone for superoxide dismutas	98.93
PRK10671		834	copA copper exporting ATPase; Provisional	98.72
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	98.61
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	98.49
PLN02957		238	copper, zinc superoxide dismutase	98.47
PRK10671		834	copA copper exporting ATPase; Provisional	98.34
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	98.13
TIGR00003		68	copper ion binding protein. This model describes a	97.83
PF00403		62	HMA: Heavy-metal-associated domain; InterPro: IPR0	97.24
KOG1603		73	consensus Copper chaperone [Inorganic ion transpor	96.84
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	96.66
COG2608		71	CopZ Copper chaperone [Inorganic ion transport and	95.59
TIGR02052		92	MerP mercuric transport protein periplasmic compon	93.95
cd00371		63	HMA Heavy-metal-associated domain (HMA) is a conse	90.91
PRK13748		561	putative mercuric reductase; Provisional	87.9
KOG4656		247	consensus Copper chaperone for superoxide dismutas	87.67
PLN02957		238	copper, zinc superoxide dismutase	80.52
PF01883		72	DUF59: Domain of unknown function DUF59; InterPro:	80.14

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

Probab=99.44  E-value=4.1e-13  Score=96.22  Aligned_cols=58  Identities=28%  Similarity=0.513  Sum_probs=53.9

Q ss_pred             EEEe-eccchhhHHHHHHHHhcCCCceEEEEeCCCCEEEEEec---CCHHHHHHHHHHhcCCC
Q 024092           86 VLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGT---MDVKELVPYLKEKLKRN  144 (272)
Q Consensus        86 ~l~V-gM~C~~Ca~kIekaL~~i~GV~~v~Vdl~~~kVtV~g~---vd~~~L~~~l~kk~G~~  144 (272)
                      +|.| +|+|++|+++|+++|.+++||.++.+|+.+++|+|.+.   +++.+|.++|+ ++||+
T Consensus         1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~-~~Gy~   62 (62)
T PF00403_consen    1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIE-KAGYE   62 (62)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHH-HTTSE
T ss_pred             CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHH-HhCcC
Confidence            5888 99999999999999999999999999999999999986   45599999999 89984

These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00003 copper ion binding protein	Back alignment and domain information

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures	Back alignment and domain information

>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02052 MerP mercuric transport protein periplasmic component	Back alignment and domain information

>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02957 copper, zinc superoxide dismutase	Back alignment and domain information

>PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		272
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	7e-11
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	3e-04
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	4e-09
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	5e-08
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	8e-07
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	2e-06
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	2e-04

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98	Back alignment and structure

 Score = 56.8 bits (137), Expect = 7e-11
 Identities = 13/66 (19%), Positives = 30/66 (45%)

Query: 74  SEEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKEL 133
           S+        T+   +++ C+ C+  ++K +    GV +V +     +V V  T+  +E+
Sbjct: 10  SDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEV 69

Query: 134 VPYLKE 139
              L+ 
Sbjct: 70  QALLEG 75

PyMOL of 2crl

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249	Back alignment and structure

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		272
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	99.61
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	99.58
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	99.58
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	99.47
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	99.47
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	99.44
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	99.43
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	99.41
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	99.33
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	99.32
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	99.31
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	99.25
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	99.24
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	99.23
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	99.23
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	99.22
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	99.21
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	99.21
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	99.2
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	99.2
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	99.19
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	99.19
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	99.18
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	99.17
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	99.17
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	99.16
2kyz_A		67	Heavy metal binding protein; structural genomics,	99.16
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	99.14
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	99.12
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	99.12
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	99.1
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	99.09
2kkh_A		95	Putative heavy metal transporter; zinc transport,	99.09
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	99.05
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	99.05
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	98.95
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	98.95
2ew9_A		149	Copper-transporting ATPase 2; copper trafficking,	98.86
2rop_A		202	Copper-transporting ATPase 2; wilson protein, mobi	98.63
1p6t_A		151	Potential copper-transporting ATPase; COPA, P-type	98.55
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.45
3iwl_A		68	Copper transport protein ATOX1; beta-alpha-beta-BE	97.59
1cc8_A		73	Protein (metallochaperone ATX1); copper transport,	97.3
2crl_A		98	Copper chaperone for superoxide dismutase; SOD1, f	97.16
4a4j_A		69	Pacszia, cation-transporting ATPase PACS; hydrolas	97.09
3dxs_X		74	Copper-transporting ATPase RAN1; CXXC motif, ferre	96.9
3fry_A		73	Probable copper-exporting P-type ATPase A; transpo	96.66
2xmm_A		64	SSR2857 protein, ATX1; metal transport, copper hom	96.63
2roe_A		66	Heavy metal binding protein; NMR {Thermus thermoph	96.49
2ofg_X		111	Zinc-transporting ATPase; ferredoxin-like fold, be	96.34
2k2p_A		85	Uncharacterized protein ATU1203; putative metal-bi	96.21
1cpz_A		68	Protein (COPZ); copper chaperone, metal transport,	96.1
2g9o_A		90	Copper-transporting ATPase 1; menkes disease, solu	96.01
1osd_A		72	MERP, hypothetical protein MERP; mercury resistanc	95.96
2l3m_A		71	Copper-ION-binding protein; structural genomics, c	95.95
2xmw_A		71	PACS-N, cation-transporting ATPase PACS; hydrolase	95.88
1aw0_A		72	Menkes copper-transporting ATPase; copper-binding	95.84
2kt2_A		69	Mercuric reductase; nmera, MERA, HMA domain, mercu	95.81
1yg0_A		66	COP associated protein; open-faced beta-sandwich,	95.69
1q8l_A		84	Copper-transporting ATPase 1; metal binding protei	95.44
1qup_A		222	Superoxide dismutase 1 copper chaperone; two domai	95.43
2qif_A		69	Copper chaperone COPZ; tetranuclear Cu(I) cluster;	95.41
3cjk_B		75	Copper-transporting ATPase 1; HAH1, ATP7B, menkes	95.38
1fvq_A		72	Copper-transporting ATPase; APO-CCC2A, hydrolase;	95.27
1yjr_A		75	Copper-transporting ATPase 1; metallochaperone, pr	95.26
1kvi_A		79	Copper-transporting ATPase 1; menkes, Cu-protein,	95.24
2ldi_A		71	Zinc-transporting ATPase; metal homeostasis, metal	95.08
1y3j_A		77	Copper-transporting ATPase 1; ferrodoxin-like fold	95.02
1mwy_A		73	ZNTA; open-faced beta-sandwich fold, beta-alpha-be	94.87
1opz_A		76	Potential copper-transporting ATPase; mutation, fo	94.87
2kyz_A		67	Heavy metal binding protein; structural genomics,	94.76
1jk9_B		249	CCS, copper chaperone for superoxide dismutase; pr	94.6
1jww_A		80	Potential copper-transporting ATPase; beta-alpha-b	93.58
2kkh_A		95	Putative heavy metal transporter; zinc transport,	93.04
2aj0_A		71	Probable cadmium-transporting ATPase; ferrodoxin-l	91.3

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

Probab=99.61  E-value=5.7e-15  Score=118.82  Aligned_cols=116  Identities=14%  Similarity=0.291  Sum_probs=96.1

Q ss_pred             CCCCCCceEEEeeccCcEEEEEee---cCHHHHHHHHHHhhccccccCCCCCCCCCCCCCCcccccccCCCCCcccccCC
Q 024092            2 LLICLGVVDVKTDCGANKVTVTGK---VEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKSEEKK   78 (272)
Q Consensus         2 L~kl~GV~~v~Vd~~~~kvtV~g~---vd~~~li~~I~~k~Gy~velvs~~pk~~~~~~e~~~~~~~~~k~~~k~~~~~~   78 (272)
                      |..++||.++.+|+.+++++|...   .+...|...|+ .+||.+.++...                             
T Consensus        26 l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~-----------------------------   75 (149)
T 2ew9_A           26 LQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDY-----------------------------   75 (149)
T ss_dssp             HHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCS-----------------------------
T ss_pred             HhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeeccc-----------------------------
Confidence            567899999999999999999863   45678999998 899976532110                             


Q ss_pred             CCCceEEEEEe-eccchhhHHHHHHHHhcCCCceEEEEeCCCCEEEEEec---CCHHHHHHHHHHhcCCCeEEc
Q 024092           79 PPKESTVVLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGT---MDVKELVPYLKEKLKRNVEVV  148 (272)
Q Consensus        79 ~~~~~~v~l~V-gM~C~~Ca~kIekaL~~i~GV~~v~Vdl~~~kVtV~g~---vd~~~L~~~l~kk~G~~aelv  148 (272)
                      .....++.|.| ||+|++|+.+|+++|.+++||.++.||+.+++++|...   +++..|+++|. ++||.+.++
T Consensus        76 ~~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~Gy~~~~~  148 (149)
T 2ew9_A           76 AGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIE-EIGFHASLA  148 (149)
T ss_dssp             CCSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHHHHH-HHTCEEECC
T ss_pred             ccccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHHHHH-hCCCceEec
Confidence            00123578999 99999999999999999999999999999999999853   57899999998 999988764

PyMOL of 2ew9

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens}	Back alignment and structure

>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens}	Back alignment and structure

>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A	Back alignment and structure

>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A	Back alignment and structure

>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A	Back alignment and structure

>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0	Back alignment and structure

>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A	Back alignment and structure

>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A	Back alignment and structure

>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str}	Back alignment and structure

>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1	Back alignment and structure

>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A	Back alignment and structure

>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A	Back alignment and structure

>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis}	Back alignment and structure

>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A	Back alignment and structure

>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A	Back alignment and structure

>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A	Back alignment and structure

>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori}	Back alignment and structure

>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A	Back alignment and structure

>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A	Back alignment and structure

>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A	Back alignment and structure

>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B	Back alignment and structure

>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A	Back alignment and structure

>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A	Back alignment and structure

>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP}	Back alignment and structure

>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A	Back alignment and structure

>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A	Back alignment and structure

>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A	Back alignment and structure

>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima}	Back alignment and structure

>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1	Back alignment and structure

>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A	Back alignment and structure

>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}	Back alignment and structure

>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		272
d1qupa2		72	d.58.17.1 (A:2-73) Copper chaperone for superoxide	4e-07
d1cc8a_		72	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	5e-06
d1osda_		72	d.58.17.1 (A:) Mercuric ion binding protein MerP {	2e-05
d2ggpb1		72	d.58.17.1 (B:1-72) Copper transporter domain ccc2a	3e-05
d1sb6a_		64	d.58.17.1 (A:) Copper chaperone {Synechocystis sp.	5e-05
d1fe0a_		66	d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX	2e-04
d1kvja_		79	d.58.17.1 (A:) Menkes copper-transporting ATPase {	3e-04
d1p6ta1		72	d.58.17.1 (A:1-72) Potential copper-translocating	3e-04
d2aw0a_		72	d.58.17.1 (A:) Menkes copper-transporting ATPase {	3e-04
d1mwza_		73	d.58.17.1 (A:) Metal ion-transporting ATPase ZntA,	0.001
d1q8la_		84	d.58.17.1 (A:) Menkes copper-transporting ATPase {	0.002
d2qifa1		69	d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt	0.002
d1p6ta2		79	d.58.17.1 (A:73-151) Potential copper-translocatin	0.002

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 44.4 bits (105), Expect = 4e-07
 Identities = 10/51 (19%), Positives = 27/51 (52%)

Query: 84  TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELV 134
                I +HCE C++ IK  +    G++++  D  + +++V+ ++    ++
Sbjct: 7   EATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTII 57

PyMOL of d1qupa2

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64	Back information, alignment and structure

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		272
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	99.67
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	99.66
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	99.65
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	99.58
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	99.58
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	99.55
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	99.54
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	99.53
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	99.51
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	99.51
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	99.5
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	99.48
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	99.47
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	99.44
d1qupa2		72	Copper chaperone for superoxide dismutase, N-termi	97.96
d1fe0a_		66	ATX1 metallochaperone protein (ATOX1) {Human (Homo	97.78
d1sb6a_		64	Copper chaperone {Synechocystis sp. pcc 6803, Scat	97.66
d1cc8a_		72	ATX1 metallochaperone protein (ATOX1) {Baker's yea	97.61
d1cpza_		68	Copper chaperone {Enterococcus hirae [TaxId: 1354]	97.55
d2ggpb1		72	Copper transporter domain ccc2a {Baker's yeast (Sa	97.49
d1kvja_		79	Menkes copper-transporting ATPase {Human (Homo sap	97.27
d1osda_		72	Mercuric ion binding protein MerP {Ralstonia metal	97.21
d2aw0a_		72	Menkes copper-transporting ATPase {Human (Homo sap	97.16
d1p6ta1		72	Potential copper-translocating P-type ATPase CopA	97.09
d1q8la_		84	Menkes copper-transporting ATPase {Human (Homo sap	97.08
d2qifa1		69	Copper chaperone {Bacillus subtilis, CopZ [TaxId:	97.02
d1p6ta2		79	Potential copper-translocating P-type ATPase CopA	96.99
d1mwza_		73	Metal ion-transporting ATPase ZntA, N-terminal dom	96.83
d1uwda_		102	Hypothetical protein TM0487 {Thermotoga maritima [	87.36

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.67  E-value=8e-17  Score=115.63  Aligned_cols=64  Identities=22%  Similarity=0.423  Sum_probs=61.0

Q ss_pred             EEEEEeeccchhhHHHHHHHHhcCCCceEEEEeCCCCEEEEEecCCHHHHHHHHHHhcCCCeEEcc
Q 024092           84 TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVP  149 (272)
Q Consensus        84 ~v~l~VgM~C~~Ca~kIekaL~~i~GV~~v~Vdl~~~kVtV~g~vd~~~L~~~l~kk~G~~aelv~  149 (272)
                      +++|+|+|||++|+++|+++|.+++|| ++.||+.+++|+|++.++++.|+++|+ ++||.++++.
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~-~~Gy~a~lig   65 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLG   65 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTTSCEEEEE
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHH-HhCCeEEEee
Confidence            468999999999999999999999998 699999999999999999999999998 9999999874

PyMOL of d1fe0a_

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}	Back information, alignment and structure

>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]}	Back information, alignment and structure

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}	Back information, alignment and structure

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}	Back information, alignment and structure

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}	Back information, alignment and structure

>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure