Citrus Sinensis ID: 024101

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MAVGLLAAIVPKPFCLLTTKLQPSSLLTTKPAPLFAPLGTHRGFFNGKNRRKLNSFTVCFVLEEKKQSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQVNDQIMN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcCEEEcccccccccccHHHHHHHHHHHHHccccc
***GLLAAIVPKPFCLLTTKLQPSSLLTTKPAPLFAPLGTHRGFFNGKNRRKLNSFTVCFVLE**************************************ERFTYLVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQVND****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVGLLAAIVPKPFCLLTTKLQPSSLLTTKPAPLFAPLGTHRGFFNGKNRRKLNSFTVCFVLEEKKQSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQVNDQIMN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-carotene 3-hydroxylase 2, chloroplastic Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Has also a low activity toward the beta- and epsilon-rings of alpha-carotene. No activity with acyclic carotenoids such as lycopene and neurosporene. Uses ferredoxin as an electron donor.probableQ9LTG0
Beta-carotene 3-hydroxylase, chloroplastic Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Uses ferredoxin as an electron donor.probableB3SGL0
Beta-carotene hydroxylase 1, chloroplastic Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Produces beta-cryptoxanthin and zeaxanthin. Uses ferredoxin as an electron donor.probableO49815

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H90, chain A
Confidence level:probable
Coverage over the Query: 91-175,189-240
View the alignment between query and template
View the model in PyMOL