Citrus Sinensis ID: 024102

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
cccccccccHHHHHHHHHHHHHHccccHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccccccccHHHHHHHHHHHHccccccHHHHHcccccHHHHHccccccHHHHHHccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEcccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mgnqkqkwTAEEEEALLAGVAkhgpgkwknilrdpqfapsltqrsnidlkdkwrnlsvsnaqqgskdkirgpklkttvvaplsntpnsapaasltrnvssgavmndtstsaldgkngpkyNAMIFEAISTlkdangsdiSAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKirketsigvktptpkqkdarlrpprnsalmTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
mgnqkqkwTAEEEEALLAGVAKHGPGKWKNILrdpqfapsltqrsnidlkdkwrnLSVSnaqqgskdkirgpkLKTTVVAplsntpnsapaasltrnvssgavMNDTstsaldgkngpKYNAMIFEAISTLKDANGSDISAIANFIeerqeappnFRRLLSSRLRrlvsqgklekvrncykirketsigvktptpkqkdarlrpprnsalmtsrEIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
MGNQKQKWTaeeeeallaGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFrrllssrlrrlVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
*******************V*****GKWKNIL***************************************************************************************YNAMIFEAISTLKDANGSDISAIANFI*****************LRRLVSQGKLEKVRNCYKIR************************************ASITAAYRIAEAENKSFLAA******************MLQLVKEIYE*****
***QKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQ***************************************************KNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVR************************************************************************KMAEDTDAMLQLVKEIYERCSFV
**********EEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSV*********KIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVK**************RNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
*******WTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNA******************************************************NGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIR*******************************EIVEE******YRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query272 2.2.26 [Sep-21-2011]
F4I7L1296 Telomere repeat-binding f yes no 0.985 0.905 0.541 2e-71
F4IEY4287 Telomere repeat-binding f no no 0.988 0.937 0.489 6e-67
Q8VWK4300 Telomere repeat-binding f no no 0.669 0.606 0.435 6e-35
Q9FJW5299 Telomere repeat-binding f no no 0.632 0.575 0.401 4e-27
Q9M2X3295 Telomere repeat-binding f no no 0.636 0.586 0.402 5e-26
P23444246 Histone H1 OS=Zea mays PE N/A no 0.246 0.272 0.492 1e-12
P27806238 Histone H1 OS=Triticum ae N/A no 0.246 0.281 0.449 8e-11
P26569273 Histone H1.2 OS=Arabidops no no 0.246 0.245 0.485 5e-10
P08283265 Histone H1 OS=Pisum sativ N/A no 0.238 0.245 0.484 8e-07
P26568274 Histone H1.1 OS=Arabidops no no 0.246 0.244 0.514 2e-06
>sp|F4I7L1|TRB4_ARATH Telomere repeat-binding factor 4 OS=Arabidopsis thaliana GN=At1g17520 PE=2 SV=2 Back     alignment and function desciption
 Score =  269 bits (687), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 202/290 (69%), Gaps = 22/290 (7%)

Query: 1   MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
           MGNQK KWTAEEEEALLAGV KHGPGKWKNILRDP+ A  L+ RSNIDLKDKWRNLSV+ 
Sbjct: 1   MGNQKLKWTAEEEEALLAGVRKHGPGKWKNILRDPELAEQLSSRSNIDLKDKWRNLSVAP 60

Query: 61  AQQGSKDKIRGPKLK-----------TTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTST 109
             QGSKDKIR PK+K             +V P +++ +S+P A+L R+ SS   ++D+  
Sbjct: 61  GIQGSKDKIRTPKIKAAAFHLAAAAAAAIVTP-THSGHSSPVATLPRSGSSDLSIDDSFN 119

Query: 110 SALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVS 169
              D KN P+Y+ MIFEA+S L DANGSD+SAI NFIE+RQE PPNFRR+LSSRLRRL +
Sbjct: 120 IVADPKNAPRYDGMIFEALSNLTDANGSDVSAIFNFIEQRQEVPPNFRRMLSSRLRRLAA 179

Query: 170 QGKLEKV------RNCYKIRKETSIGVKTPT---PKQKDARLRPPRNSALMTSREIVEEA 220
           QGKLEKV      +N YK+  + S+  +TP    PK+ + + R   NS   +  + + EA
Sbjct: 180 QGKLEKVSHLKSTQNFYKMN-DNSLVQRTPHVARPKESNTKSRQQTNSQGPSISQQIVEA 238

Query: 221 SITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCS 270
           SITAAY++ E ENK  ++  A +E ER+ K+AE+ D ML + +E++E CS
Sbjct: 239 SITAAYKLVEVENKLDVSKGAAEEIERLMKLAEEADEMLVIAREMHEECS 288
Binds preferentially double-stranded telomeric repeats.
Arabidopsis thaliana (taxid: 3702)
>sp|F4IEY4|TRB5_ARATH Telomere repeat-binding factor 5 OS=Arabidopsis thaliana GN=At1g72740 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWK4|TRB1_ARATH Telomere repeat-binding factor 1 OS=Arabidopsis thaliana GN=TRB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJW5|TRB2_ARATH Telomere repeat-binding factor 2 OS=Arabidopsis thaliana GN=TRB2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2X3|TRB3_ARATH Telomere repeat-binding factor 3 OS=Arabidopsis thaliana GN=TRB3 PE=1 SV=1 Back     alignment and function description
>sp|P23444|H1_MAIZE Histone H1 OS=Zea mays PE=2 SV=2 Back     alignment and function description
>sp|P27806|H1_WHEAT Histone H1 OS=Triticum aestivum PE=2 SV=2 Back     alignment and function description
>sp|P26569|H12_ARATH Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 PE=1 SV=1 Back     alignment and function description
>sp|P08283|H1_PEA Histone H1 OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P26568|H11_ARATH Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
449458153279 PREDICTED: telomere repeat-binding facto 0.981 0.956 0.656 1e-93
307135862279 MYB transcription factor [Cucumis melo s 0.981 0.956 0.656 2e-93
255560719349 transcription factor, putative [Ricinus 0.966 0.753 0.7 1e-91
356522138285 PREDICTED: uncharacterized protein LOC78 0.985 0.940 0.587 1e-82
351722098281 MYB transcription factor MYB107 [Glycine 0.977 0.946 0.595 4e-82
255648160281 unknown [Glycine max] 0.977 0.946 0.595 1e-81
110931744275 MYB transcription factor MYB91 [Glycine 0.977 0.967 0.581 5e-81
224122558279 single myb histone [Populus trichocarpa] 0.963 0.939 0.606 4e-78
255546151283 DNA binding protein, putative [Ricinus c 0.992 0.954 0.581 4e-75
224087971275 single myb histone [Populus trichocarpa] 0.966 0.956 0.588 9e-73
>gi|449458153|ref|XP_004146812.1| PREDICTED: telomere repeat-binding factor 5-like [Cucumis sativus] gi|449476637|ref|XP_004154792.1| PREDICTED: telomere repeat-binding factor 5-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 180/274 (65%), Positives = 216/274 (78%), Gaps = 7/274 (2%)

Query: 1   MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
           MGNQKQKWT+EEE+ALLAGV KHGPGKWKNIL+DP FAPSLT RSNIDLKDKWRNLSVS 
Sbjct: 1   MGNQKQKWTSEEEDALLAGVNKHGPGKWKNILKDPDFAPSLTHRSNIDLKDKWRNLSVST 60

Query: 61  AQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDT-STSALDGKNGPK 119
           A QGSK+K R       +VA +SN   SAPA     N S+ A  +DT + S  DGKN P+
Sbjct: 61  ASQGSKEKSRAAPKAKAIVAAISNNQTSAPAKP---NASADAAGDDTPNNSTQDGKNVPR 117

Query: 120 YNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNC 179
           Y +MIFEA+ST+KD+NG DI  I NFIE+R E P NFRR LSS+LRRLVSQGKLEKV+NC
Sbjct: 118 YYSMIFEALSTIKDSNGCDIGTIVNFIEQRHEVPQNFRRQLSSKLRRLVSQGKLEKVQNC 177

Query: 180 YKIRKETSIGVKTPTPKQKDARLRPPR---NSALMTSREIVEEASITAAYRIAEAENKSF 236
           Y+++K+ S+ VKTPTPKQKD R R  +      +M S E VE+A+  AAY++A+AENKSF
Sbjct: 178 YRVKKDNSLAVKTPTPKQKDVRQRISQYNTTGGVMPSAETVEDAAKAAAYKVADAENKSF 237

Query: 237 LAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCS 270
           LAAEA KEAER++KMAEDTD+MLQ++KE+YE+CS
Sbjct: 238 LAAEAVKEAERIAKMAEDTDSMLQIIKEMYEKCS 271

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|307135862|gb|ADN33730.1| MYB transcription factor [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|255560719|ref|XP_002521373.1| transcription factor, putative [Ricinus communis] gi|223539451|gb|EEF41041.1| transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356522138|ref|XP_003529706.1| PREDICTED: uncharacterized protein LOC780537 [Glycine max] Back     alignment and taxonomy information
>gi|351722098|ref|NP_001237744.1| MYB transcription factor MYB107 [Glycine max] gi|110931702|gb|ABH02850.1| MYB transcription factor MYB107 [Glycine max] Back     alignment and taxonomy information
>gi|255648160|gb|ACU24534.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|110931744|gb|ABH02871.1| MYB transcription factor MYB91 [Glycine max] Back     alignment and taxonomy information
>gi|224122558|ref|XP_002330511.1| single myb histone [Populus trichocarpa] gi|222872445|gb|EEF09576.1| single myb histone [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255546151|ref|XP_002514135.1| DNA binding protein, putative [Ricinus communis] gi|223546591|gb|EEF48089.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224087971|ref|XP_002308277.1| single myb histone [Populus trichocarpa] gi|222854253|gb|EEE91800.1| single myb histone [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
TAIR|locus:2030275287 AT1G72740 [Arabidopsis thalian 0.974 0.923 0.415 4e-51
TAIR|locus:2007878296 AT1G17520 [Arabidopsis thalian 0.933 0.858 0.440 1.4e-48
TAIR|locus:2031095300 TRB1 "telomere repeat binding 0.970 0.88 0.340 7.9e-30
TAIR|locus:2158611299 TRB2 "AT5G67580" [Arabidopsis 0.908 0.826 0.319 1.8e-23
TAIR|locus:2097325295 TRB3 "telomere repeat binding 0.926 0.854 0.305 3e-21
TAIR|locus:2020193197 AT1G54260 [Arabidopsis thalian 0.540 0.746 0.352 1.6e-13
TAIR|locus:2020183229 AT1G54240 [Arabidopsis thalian 0.665 0.790 0.294 9.1e-10
TAIR|locus:2033118274 AT1G06760 [Arabidopsis thalian 0.665 0.660 0.287 1.7e-07
TAIR|locus:2064332273 AT2G30620 [Arabidopsis thalian 0.496 0.494 0.296 6.4e-07
TAIR|locus:2060984167 HIS1-3 "histone H1-3" [Arabido 0.297 0.485 0.361 6.6e-06
TAIR|locus:2030275 AT1G72740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 531 (192.0 bits), Expect = 4.0e-51, P = 4.0e-51
 Identities = 118/284 (41%), Positives = 162/284 (57%)

Query:     1 MGNQKQKWTXXXXXXXXXGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
             MGNQK KWT         G+ KHGPGKWKNILRDP+FA  L  RSNIDLKDKWRNLSV  
Sbjct:     1 MGNQKLKWTAEEEEALLAGIRKHGPGKWKNILRDPEFADQLIHRSNIDLKDKWRNLSVPP 60

Query:    61 AQQGSKDKIRGPKLKTTVVAPLSNTPNSA----PAASLT----RNVSSGAVMNDTSTSAL 112
               Q   +K R  K+K     P ++  ++     P  ++     R      ++ D +T   
Sbjct:    61 GTQSLTNKARPAKVKEEGDTPAADANDAVTIPRPIPTIPPPPGRRTLPSELIPDENT--- 117

Query:   113 DGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFXXXXXXXXXXXVSQGK 172
               KN P+Y+ +IFEA+S L D NGSD+S+I +FIE R E PPNF            +Q K
Sbjct:   118 --KNAPRYDGVIFEALSALADGNGSDVSSIYHFIEPRHEVPPNFRRILSTRLRRLAAQSK 175

Query:   173 LEKV------RNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAY 226
             LEKV      +N YKI   +   +  P PK+   +LR   N     S++++EEA+ITAA 
Sbjct:   176 LEKVSTFKSIQNFYKIPDPSGTKIGVPKPKETHTKLRQANNQTSADSQQMIEEAAITAAC 235

Query:   227 RIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCS 270
             ++ EAENK  +A  A +E E+++K+AE+   +L +  E++E CS
Sbjct:   236 KVVEAENKIDVAKLAAEEFEKMTKIAEENRKLLVIATEMHELCS 279
GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006334 "nucleosome assembly" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
TAIR|locus:2007878 AT1G17520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031095 TRB1 "telomere repeat binding factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158611 TRB2 "AT5G67580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097325 TRB3 "telomere repeat binding factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020193 AT1G54260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020183 AT1G54240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033118 AT1G06760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064332 AT2G30620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060984 HIS1-3 "histone H1-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4I7L1TRB4_ARATHNo assigned EC number0.54130.98520.9054yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 1e-19
smart0052666 smart00526, H15, Domain in histone families 1 and 3e-18
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-09
cd0007388 cd00073, H15, linker histone 1 and histone 5 domai 7e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-08
pfam0053877 pfam00538, Linker_histone, linker histone H1 and H 8e-07
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information 
 Score = 79.5 bits (197), Expect = 1e-19
 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 3/51 (5%)

Query: 6  QKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNL 56
          +KWT EE+EAL+ GV K+G G W  IL+D  F   +  R+++DLKDKWRNL
Sbjct: 1  RKWTDEEDEALVEGVEKYGVGNWAKILKDYFF---VNNRTSVDLKDKWRNL 48

Human telomere repeat binding factors, TRF1 and TRF2, function as part of the 6 component shelterin complex. TRF2 binds DNA and recruits RAP1 (via binding to the RAP1 protein c-terminal (RCT)) and TIN2 in the protection of telomeres from DNA repair machinery. Metazoan shelterin consists of 3 DNA binding proteins (TRF2, TRF1, and POT1) and 3 recruited proteins that bind to one or more of these DNA-binding proteins (RAP1, TIN2, TPP1). Schizosaccharomyces pombe TAZ1 is an orthlog and binds RAP1. Human TRF1 and TRF2 bind double-stranded DNA. hTRF2 consists of a basic N-terminus, a TRF homology domain, the RAP1 binding motif (RBM), the TIN2 binding motif (TBM) and a myb-like DNA binding domain, SANT, named after 'SWI3, ADA2, N-CoR and TFIIIB', several factors that share this domain. Tandem copies of the domain bind telomeric DNA tandem repeats as part of the capping complex. The single myb-like domain of TRF-type proteins is similar to the tandem myb_like domains found in yeast RAP1. Length = 50
>gnl|CDD|197772 smart00526, H15, Domain in histone families 1 and 5 Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238028 cd00073, H15, linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215982 pfam00538, Linker_histone, linker histone H1 and H5 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 272
cd0007388 H15 linker histone 1 and histone 5 domains; the ba 99.84
smart0052666 H15 Domain in histone families 1 and 5. 99.84
PF0053877 Linker_histone: linker histone H1 and H5 family; I 99.84
KOG4012243 consensus Histone H1 [Chromatin structure and dyna 99.51
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.35
PLN03212249 Transcription repressor MYB5; Provisional 99.09
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.08
PLN03091 459 hypothetical protein; Provisional 99.0
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.97
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.95
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.92
PLN03212249 Transcription repressor MYB5; Provisional 98.61
PLN03091 459 hypothetical protein; Provisional 98.5
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.1
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.03
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.89
KOG0051607 consensus RNA polymerase I termination factor, Myb 97.62
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.61
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.4
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.12
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.53
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.38
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.01
KOG1279506 consensus Chromatin remodeling factor subunit and 95.99
COG5147512 REB1 Myb superfamily proteins, including transcrip 95.55
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.39
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 95.27
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 95.16
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.02
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.53
PF08074173 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR01295 94.42
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 93.63
PF1026480 Stork_head: Winged helix Storkhead-box1 domain; In 93.26
PF1433892 Mrr_N: Mrr N-terminal domain 93.13
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 92.51
cd0005978 FH Forkhead (FH), also known as a "winged helix". 91.21
KOG0051607 consensus RNA polymerase I termination factor, Myb 90.22
KOG03841373 consensus Chromodomain-helicase DNA-binding protei 90.02
KOG2656445 consensus DNA methyltransferase 1-associated prote 89.36
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 89.34
KOG4282345 consensus Transcription factor GT-2 and related pr 89.24
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 87.82
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 84.36
PF09420164 Nop16: Ribosome biogenesis protein Nop16; InterPro 80.18
>cd00073 H15 linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information 
Probab=99.84  E-value=5.9e-21  Score=149.13  Aligned_cols=71  Identities=37%  Similarity=0.653  Sum_probs=67.1

Q ss_pred             CCCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCC-cchHHHHHHHHHhhhhcCceeeec-----cccccCCC
Q 024102          115 KNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAP-PNFRRLLSSRLRRLVSQGKLEKVR-----NCYKIRKE  185 (272)
Q Consensus       115 ~~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~-~n~~~~L~~~LKrlV~~GkLvkvK-----~sykl~~~  185 (272)
                      .+||+|.+||+|||.+|+|++|||+++|++||+++|.+. ++|+.+|+.+|+++|++|.|++++     |+|+|++.
T Consensus         2 ~~hP~y~~MI~eAI~~l~er~GsS~~aI~kyI~~~y~~~~~~~~~~l~~aLkk~v~~G~l~~~kG~g~~gsfkl~~~   78 (88)
T cd00073           2 PSHPPYSEMVTEAIKALKERKGSSLQAIKKYIEAKYKVDDENFNKLLKLALKKGVAKGKLVQVKGTGASGSFKLSKK   78 (88)
T ss_pred             CCCCCHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHCCcchHHHHHHHHHHHHHHHHCCCeEeecCCCCccceEeCCC
Confidence            579999999999999999999999999999999999765 899999999999999999999999     89999743

>smart00526 H15 Domain in histone families 1 and 5 Back     alignment and domain information
>PF00538 Linker_histone: linker histone H1 and H5 family; InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication) Back     alignment and domain information
>KOG4012 consensus Histone H1 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08074 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR012957 The CHDCT2 C-terminal domain is found in PHD/RING fingers and chromo domain-associated CHD-like helicases [] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF10264 Stork_head: Winged helix Storkhead-box1 domain; InterPro: IPR019391 In humans the Storkhead-box protein controls polyploidization of extravillus trophoblast and is implicated in pre-eclampsia [] Back     alignment and domain information
>PF14338 Mrr_N: Mrr N-terminal domain Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00339 FH FORKHEAD Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF09420 Nop16: Ribosome biogenesis protein Nop16; InterPro: IPR019002 Nucleolar protein 16 (Nop16) is a protein involved in the biogenesis of the 60S ribosomal subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 9e-21
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-20
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-19
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-18
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-18
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-16
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 6e-16
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-14
1hst_A90 Histone H5; chromosomal protein; 2.60A {Gallus gal 3e-12
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 2e-10
1ghc_A75 GH1; chromosomal protein; NMR {Gallus gallus} SCOP 9e-10
1uss_A88 Histone H1; DNA binding protein, linker histone, D 1e-09
1ust_A93 Histone H1; DNA binding protein, linker histone, D 4e-09
2rqp_A88 Heterochromatin protein 1-binding protein 3; histo 5e-09
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-07
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-06
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 4e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-06
2lso_A83 Histone H1X; structural genomics, northeast struct 6e-06
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-05
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 2e-05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 7e-05
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-04
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-04
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 3e-04
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 9e-21
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 4  QKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNL 56
          +KQKWT EE E + AGV K+G G W  I ++  F      R+ + +KD+WR +
Sbjct: 1  KKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPF----VNRTAVMIKDRWRTM 49
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1hst_A Histone H5; chromosomal protein; 2.60A {Gallus gallus} SCOP: a.4.5.13 Length = 90 Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Length = 78 Back     alignment and structure
>1ghc_A GH1; chromosomal protein; NMR {Gallus gallus} SCOP: a.4.5.13 Length = 75 Back     alignment and structure
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Length = 88 Back     alignment and structure
>2rqp_A Heterochromatin protein 1-binding protein 3; histone H1, alternative splicing, chromosomal protein, DNA-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 62 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2lso_A Histone H1X; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, nuclear protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Length = 211 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
1hst_A90 Histone H5; chromosomal protein; 2.60A {Gallus gal 99.88
1uss_A88 Histone H1; DNA binding protein, linker histone, D 99.88
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 99.87
1ust_A93 Histone H1; DNA binding protein, linker histone, D 99.85
2rqp_A88 Heterochromatin protein 1-binding protein 3; histo 99.84
1ghc_A75 GH1; chromosomal protein; NMR {Gallus gallus} SCOP 99.79
2lso_A83 Histone H1X; structural genomics, northeast struct 99.61
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.75
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.74
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.7
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.7
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.69
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.53
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.5
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.49
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.4
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.37
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.28
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.26
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.26
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.25
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.24
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.22
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.22
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.22
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.19
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.13
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.13
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.09
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.08
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.05
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.02
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.02
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.02
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.99
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.53
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.77
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.72
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.47
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.36
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.07
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.01
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.92
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.91
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.81
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 97.4
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.36
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.34
2crg_A70 Metastasis associated protein MTA3; transcription 97.2
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.15
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 96.9
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.79
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.67
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.51
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.19
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 95.43
2c6y_A111 Forkhead box protein K2; transcription regulation, 94.69
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 93.65
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 94.14
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.53
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.41
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.2
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 93.2
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 93.06
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 92.6
2hdc_A97 Protein (transcription factor); structure, dyanami 92.38
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 91.42
3bpy_A85 FORK head domain, forkhead transcription factor FO 89.77
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 89.71
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 89.49
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.11
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 82.92
>1hst_A Histone H5; chromosomal protein; 2.60A {Gallus gallus} SCOP: a.4.5.13 Back     alignment and structure
Probab=99.88  E-value=5e-23  Score=161.08  Aligned_cols=74  Identities=24%  Similarity=0.429  Sum_probs=67.2

Q ss_pred             CCCCCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCCcchHHHHHHHHHhhhhcCceeeecc-----ccccCCCC
Q 024102          113 DGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRN-----CYKIRKET  186 (272)
Q Consensus       113 ~~~~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~~n~~~~L~~~LKrlV~~GkLvkvK~-----sykl~~~~  186 (272)
                      .+.+||+|.+||+|||.+|+||+|||++||++||+++|+++++|+.+|+.+|++||++|.|+|++|     +|||++..
T Consensus         3 ~~~~hP~y~~MI~eAI~~lker~GsS~~AI~KyI~~~y~~~~~~~~~l~~aLk~~v~~G~l~q~Kg~GasGsfkl~~~~   81 (90)
T 1hst_A            3 RSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSD   81 (90)
T ss_dssp             ---CCCCHHHHHHHHHHTCCCSSCEEHHHHHHHHHHHSCCCTTHHHHHHHHHHHHHHTTSEEEECCSSCCCEEEECC--
T ss_pred             CCCCCCCHHHHHHHHHHHhccCCCCCHHHHHHHHHHHccCchhHHHHHHHHHHHHHHcCCeeeecCCCccceeecCCCc
Confidence            356899999999999999999999999999999999999977899999999999999999999998     99998754
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Back     alignment and structure
>2rqp_A Heterochromatin protein 1-binding protein 3; histone H1, alternative splicing, chromosomal protein, DNA-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1ghc_A GH1; chromosomal protein; NMR {Gallus gallus} SCOP: a.4.5.13 Back     alignment and structure
>2lso_A Histone H1X; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 272
d1hsta_74 a.4.5.13 (A:) Histone H5, globular domain {Chicken 1e-15
d1ghca_75 a.4.5.13 (A:) Histone H1, globular domain {Chicken 8e-15
d1usta_92 a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's 2e-14
d1ussa_88 a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's 7e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-11
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-10
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-09
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-06
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 6e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-04
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-04
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 0.002
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 0.003
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 0.004
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Linker histone H1/H5
domain: Histone H5, globular domain
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score = 67.8 bits (166), Expect = 1e-15
 Identities = 17/61 (27%), Positives = 29/61 (47%)

Query: 117 GPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKV 176
            P Y+ MI  AI   K   GS   +I  +I+   +   N    +   +RRL++ G L++ 
Sbjct: 2   HPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQT 61

Query: 177 R 177
           +
Sbjct: 62  K 62
>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 88 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
d1hsta_74 Histone H5, globular domain {Chicken (Gallus gallu 99.89
d1ussa_88 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 99.86
d1usta_92 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 99.85
d1ghca_75 Histone H1, globular domain {Chicken (Gallus gallu 99.82
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.72
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.66
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.29
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.2
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.19
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.1
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.09
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 99.03
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.84
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.74
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.47
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.85
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.17
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.05
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 96.93
d2fnaa173 Hypothetical protein SSO1545, C-terminal domain {S 95.86
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.24
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 94.23
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 93.07
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 91.85
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 91.54
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 91.41
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 90.28
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 85.78
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Linker histone H1/H5
domain: Histone H5, globular domain
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.89  E-value=1e-23  Score=157.49  Aligned_cols=68  Identities=25%  Similarity=0.451  Sum_probs=65.9

Q ss_pred             CCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCCcchHHHHHHHHHhhhhcCceeeec-----cccccC
Q 024102          116 NGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVR-----NCYKIR  183 (272)
Q Consensus       116 ~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~~n~~~~L~~~LKrlV~~GkLvkvK-----~sykl~  183 (272)
                      +||+|.+||+|||.+|+||+|||++||++||+++|.++.+|+.+|+.+|+++|++|.|+|+|     |+|||+
T Consensus         1 sHP~y~~MI~eAI~al~er~GsS~~AI~kyI~~~y~~~~~~~~~l~~aLk~~v~~G~l~q~kg~GasGsfkl~   73 (74)
T d1hsta_           1 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLA   73 (74)
T ss_dssp             CCCCHHHHHHHHHHTCCCSSCEEHHHHHHHHHHHSCCCTTHHHHHHHHHHHHHHTTSEEEECCSSCCCEEEEC
T ss_pred             CCCCHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHCCCchhHHHHHHHHHHHHHHcCcEEeeccCCCcceeecC
Confidence            69999999999999999999999999999999999999999999999999999999999999     499996
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure