Citrus Sinensis ID: 024105

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MAERGGERGAFGRGFGRGGRGDRGGPRGRRRAGRREEEEKWVPVTKLGRLVREGKIRSLEQIYLHSLPIKEYQIIDTLIGHKLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDTDGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGRPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFECLLKTYGFLTPDFWRETRFVKSPYQEYTDLLTPKPINKAVITEVDQAEP
ccccccccccccccccccccccccccccccccccccccccCECccccccHHcccccccHHHHHHccccccHHHHHHHHccccccccEEEEEEEEECcccccCEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccCECcEEEEECccEEEcccccccccEEEEcccHHHHHHHccccCEECcccccccccccHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHccccccccEECccccccc
****************************************WVPVTKLGRLVREGKIRSLEQIYLHSLPIKEYQIIDTLIGHKLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDTDGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGRPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFECLLKTYGFLTPDFWRETRFVKSPYQEYTDLLTPKPINKAVI********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAERGGERGAFGRGFGRGGRGDRGGPRGRRRAGRREEEEKWVPVTKLGRLVREGKIRSLEQIYLHSLPIKEYQIIDTLIGHKLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDTDGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGRPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFECLLKTYGFLTPDFWRETRFVKSPYQEYTDLLTPKPINKAVITEVDQAEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S2 confidentO74892
40S ribosomal protein S2-4 confidentQ9SCM3
40S ribosomal protein S2 Has a specific developmental role during oogenesis and a general role in protein synthesis as a component of the small ribosomal subunit.confidentP31009

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain E
Confidence level:very confident
Coverage over the Query: 33-261
View the alignment between query and template
View the model in PyMOL