Citrus Sinensis ID: 024149


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDRGWDDHVRLIYSFHYPKIRS
cccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHEEEEECccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccccccEEEEEEEcccccc
**************************************APLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDRGWDDHVRLIYSFHYPKIR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDRGWDDHVRLIYSFHYPKIRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aquaporin PIP1-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.confidentQ7XSQ9
Probable aquaporin PIP1-4 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.confidentQ39196
Aquaporin PIP1-3 Water channel required to facilitate the transport of water across cell membrane. Its function is impaired by Hg(2+).confidentQ08733

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CN5, chain A
Confidence level:very confident
Coverage over the Query: 47-270
View the alignment between query and template
View the model in PyMOL