Citrus Sinensis ID: 024153


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDEEYDSMLGVVRETPAELILPDNVMQDKVPKTA
ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccEEccccEEEEEEEEccccEEccccEEEcccccEEEccccccccccEEEEcccccccccccEEEccccEEccccEEEcEEEccccEEEEccEEccccEEccccEEccccccccccECccccEEEcccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHcccccccccccccccccccccccccc
****GKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDEEYDSMLGVVRETPAELILPDNV*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDEEYDSMLGVVRETPAELILPDNVMQDKVPKTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma carbonic anhydrase 1, mitochondrial Enzyme involved in the catabolism of H(2)CO(3) but that does not mediates the reversible hydration of carbon dioxide. Mediates complex I assembly in mitochondria and respiration.confidentQ9FWR5
Gamma carbonic anhydrase 3, mitochondrial Enzyme involved in the catabolism of H(2)CO(3) but that does not mediates the reversible hydration of carbon dioxide. Mediates complex I assembly in mitochondria and respiration.probableQ94AU7
Uncharacterized protein DDB_G0288155 probableQ54JC2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FS8, chain A
Confidence level:very confident
Coverage over the Query: 48-193
View the alignment between query and template
View the model in PyMOL
Template: 3IXC, chain A
Confidence level:very confident
Coverage over the Query: 44-214
View the alignment between query and template
View the model in PyMOL
Template: 1QRE, chain A
Confidence level:very confident
Coverage over the Query: 39-214
View the alignment between query and template
View the model in PyMOL