Citrus Sinensis ID: 024153
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| 449457524 | 271 | PREDICTED: gamma carbonic anhydrase 1, m | 1.0 | 1.0 | 0.907 | 1e-147 | |
| 449499995 | 271 | PREDICTED: gamma carbonic anhydrase 1, m | 1.0 | 1.0 | 0.900 | 1e-146 | |
| 225458237 | 272 | PREDICTED: uncharacterized protein DDB_G | 1.0 | 0.996 | 0.896 | 1e-145 | |
| 255538694 | 271 | Protein yrdA, putative [Ricinus communis | 0.992 | 0.992 | 0.907 | 1e-144 | |
| 225458239 | 280 | PREDICTED: uncharacterized protein DDB_G | 1.0 | 0.967 | 0.870 | 1e-143 | |
| 449469963 | 273 | PREDICTED: gamma carbonic anhydrase 1, m | 0.992 | 0.985 | 0.892 | 1e-142 | |
| 224134252 | 271 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.889 | 1e-142 | |
| 255538692 | 271 | Protein yrdA, putative [Ricinus communis | 0.992 | 0.992 | 0.892 | 1e-142 | |
| 224082886 | 271 | predicted protein [Populus trichocarpa] | 0.992 | 0.992 | 0.888 | 1e-141 | |
| 224066191 | 271 | predicted protein [Populus trichocarpa] | 0.981 | 0.981 | 0.890 | 1e-140 |
| >gi|449457524|ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 528 bits (1360), Expect = e-147, Method: Compositional matrix adjust.
Identities = 246/271 (90%), Positives = 264/271 (97%)
Query: 1 MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF 60
MGTLGKAIY+VGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVV+KD F
Sbjct: 1 MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF 60
Query: 61 LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT 120
+APSASIIGDVQVGRGSSIWYGCVLRGDVNSIS+GSGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct: 61 VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT 120
Query: 121 IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV 180
IIGDNVTVGHSAVLHGCT+EDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNT++PCGEV
Sbjct: 121 IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV 180
Query: 181 WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE 240
WGGNPA+FLRKLTEEEM FISQSAINYSNL++VHAAEN KSFDEIE EK+LRKKFARRDE
Sbjct: 181 WGGNPAKFLRKLTEEEMVFISQSAINYSNLSQVHAAENVKSFDEIELEKVLRKKFARRDE 240
Query: 241 EYDSMLGVVRETPAELILPDNVMQDKVPKTA 271
+YDSMLGVVRETP EL+LPDN++ DKV K++
Sbjct: 241 DYDSMLGVVRETPPELVLPDNILADKVAKSS 271
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449499995|ref|XP_004160973.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225458237|ref|XP_002282021.1| PREDICTED: uncharacterized protein DDB_G0288155 isoform 1 [Vitis vinifera] gi|147856360|emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera] gi|302142516|emb|CBI19719.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255538694|ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis] gi|223551113|gb|EEF52599.1| Protein yrdA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225458239|ref|XP_002282034.1| PREDICTED: uncharacterized protein DDB_G0288155 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449469963|ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis sativus] gi|449520036|ref|XP_004167040.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224134252|ref|XP_002327793.1| predicted protein [Populus trichocarpa] gi|222836878|gb|EEE75271.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255538692|ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis] gi|223551112|gb|EEF52598.1| Protein yrdA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224082886|ref|XP_002306878.1| predicted protein [Populus trichocarpa] gi|222856327|gb|EEE93874.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224066191|ref|XP_002302024.1| predicted protein [Populus trichocarpa] gi|118486617|gb|ABK95146.1| unknown [Populus trichocarpa] gi|222843750|gb|EEE81297.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| TAIR|locus:2013104 | 275 | GAMMA CA1 "gamma carbonic anhy | 0.992 | 0.978 | 0.821 | 3.2e-120 | |
| TAIR|locus:2036741 | 278 | GAMMA CA2 "gamma carbonic anhy | 0.996 | 0.971 | 0.756 | 5.8e-114 | |
| TAIR|locus:2154840 | 258 | GAMMA CA3 "gamma carbonic anhy | 0.937 | 0.984 | 0.748 | 2e-104 | |
| DICTYBASE|DDB_G0288155 | 246 | DDB_G0288155 "trimeric LpxA-li | 0.878 | 0.967 | 0.396 | 1e-45 | |
| TIGR_CMR|NSE_0045 | 185 | NSE_0045 "hexapeptide transfer | 0.623 | 0.913 | 0.502 | 9.9e-39 | |
| TIGR_CMR|APH_1197 | 170 | APH_1197 "hexapeptide transfer | 0.575 | 0.917 | 0.484 | 1.6e-38 | |
| TIGR_CMR|ECH_1066 | 170 | ECH_1066 "hexapeptide transfer | 0.571 | 0.911 | 0.487 | 8.9e-38 | |
| TIGR_CMR|CJE_0280 | 182 | CJE_0280 "transferase, hexapep | 0.601 | 0.895 | 0.437 | 2.7e-36 | |
| TIGR_CMR|GSU_0020 | 179 | GSU_0020 "hexapeptide transfer | 0.619 | 0.938 | 0.461 | 2.4e-35 | |
| DICTYBASE|DDB_G0278597 | 276 | DDB_G0278597 "bacterial transf | 0.638 | 0.626 | 0.410 | 1.2e-33 |
| TAIR|locus:2013104 GAMMA CA1 "gamma carbonic anhydrase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1183 (421.5 bits), Expect = 3.2e-120, P = 3.2e-120
Identities = 221/269 (82%), Positives = 247/269 (91%)
Query: 1 MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF 60
MGTLG+A YSVGFWIRETGQALDRLGCRLQG YF+EQLSRHRTLMN+FDKAP+V+K+ F
Sbjct: 1 MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF 60
Query: 61 LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT 120
+APSAS+IGDV +GRGSSIWYGCVLRGDVN++S+GSGTNIQDNSLVHVAKSNL+GKV PT
Sbjct: 61 VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT 120
Query: 121 IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV 180
IIGDNVT+GHSAVLHGCTVEDE F+GMGATLLDGV VEKH MVAAGALVRQNT+IP GEV
Sbjct: 121 IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV 180
Query: 181 WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE 240
WGGNPARFLRKLT+EE+AFISQSA NYSNLA+ HAAENAK + IEFEK+LRKK A +DE
Sbjct: 181 WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE 240
Query: 241 EYDSMLGVVRETPAELILPDNVMQDKVPK 269
EYDSMLG+VRETP EL LP+N++ DK K
Sbjct: 241 EYDSMLGIVRETPPELNLPNNILPDKETK 269
|
|
| TAIR|locus:2036741 GAMMA CA2 "gamma carbonic anhydrase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154840 GAMMA CA3 "gamma carbonic anhydrase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288155 DDB_G0288155 "trimeric LpxA-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0045 NSE_0045 "hexapeptide transferase family protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_1197 APH_1197 "hexapeptide transferase family protein" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_1066 ECH_1066 "hexapeptide transferase family protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0280 CJE_0280 "transferase, hexapeptide repeat family" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0020 GSU_0020 "hexapeptide transferase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0278597 DDB_G0278597 "bacterial transferase hexapeptide repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.57.332.1 | carbonate dehydratase (EC-4.2.1.1) (270 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| PLN02296 | 269 | PLN02296, PLN02296, carbonate dehydratase | 0.0 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 2e-84 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 2e-68 | |
| PLN02472 | 246 | PLN02472, PLN02472, uncharacterized protein | 1e-46 | |
| cd04650 | 154 | cd04650, LbH_FBP, Ferripyochelin Binding Protein ( | 5e-43 | |
| cd04745 | 155 | cd04745, LbH_paaY_like, paaY-like: This group is c | 5e-37 | |
| TIGR02287 | 192 | TIGR02287, PaaY, phenylacetic acid degradation pro | 1e-31 | |
| PRK13627 | 196 | PRK13627, PRK13627, carnitine operon protein CaiE; | 4e-26 | |
| cd00710 | 167 | cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( | 7e-21 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 1e-17 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 7e-17 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 5e-15 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 1e-14 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 2e-11 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 2e-11 | |
| TIGR03532 | 231 | TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6 | 7e-11 | |
| cd03359 | 161 | cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 | 9e-09 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 4e-08 | |
| cd03349 | 145 | cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT) | 2e-07 | |
| cd03350 | 139 | cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri | 6e-07 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 1e-06 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 1e-06 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 2e-06 | |
| cd05825 | 107 | cd05825, LbH_wcaF_like, wcaF-like: This group is c | 2e-06 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 4e-06 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 5e-06 | |
| cd03357 | 169 | cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase | 8e-06 | |
| cd03354 | 101 | cd03354, LbH_SAT, Serine acetyltransferase (SAT): | 1e-05 | |
| PLN02739 | 355 | PLN02739, PLN02739, serine acetyltransferase | 1e-05 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 2e-05 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 3e-05 | |
| TIGR02353 | 695 | TIGR02353, NRPS_term_dom, non-ribosomal peptide sy | 3e-05 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 4e-05 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 5e-05 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 8e-05 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 8e-05 | |
| PRK10092 | 183 | PRK10092, PRK10092, maltose O-acetyltransferase; P | 8e-05 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 2e-04 | |
| COG2171 | 271 | COG2171, DapD, Tetrahydrodipicolinate N-succinyltr | 2e-04 | |
| TIGR03308 | 204 | TIGR03308, phn_thr-fam, phosphonate metabolim prot | 2e-04 | |
| PRK14357 | 448 | PRK14357, glmU, bifunctional N-acetylglucosamine-1 | 2e-04 | |
| PRK09677 | 192 | PRK09677, PRK09677, putative lipopolysaccharide bi | 2e-04 | |
| TIGR02353 | 695 | TIGR02353, NRPS_term_dom, non-ribosomal peptide sy | 4e-04 | |
| PLN02694 | 294 | PLN02694, PLN02694, serine O-acetyltransferase | 5e-04 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 6e-04 | |
| PRK10502 | 182 | PRK10502, PRK10502, putative acyl transferase; Pro | 7e-04 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 8e-04 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 8e-04 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 0.001 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 0.002 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 0.002 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 0.002 |
| >gnl|CDD|215167 PLN02296, PLN02296, carbonate dehydratase | Back alignment and domain information |
|---|
Score = 575 bits (1485), Expect = 0.0
Identities = 244/269 (90%), Positives = 261/269 (97%)
Query: 1 MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF 60
MGTLG+AIY+VGFWIRETGQALDRLGCRLQGNYYF+EQLSRHRTLMNIFDKAPVV+KD F
Sbjct: 1 MGTLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFREQLSRHRTLMNIFDKAPVVDKDAF 60
Query: 61 LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT 120
+APSAS+IGDVQVGRGSSIWYGCVLRGDVNSIS+GSGTNIQDNSLVHVAK+NL+GKVLPT
Sbjct: 61 VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKTNLSGKVLPT 120
Query: 121 IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV 180
IIGDNVT+GHSAVLHGCTVEDEAFVGMGATLLDGV VEKHAMVAAGALVRQNT+IP GEV
Sbjct: 121 IIGDNVTIGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV 180
Query: 181 WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE 240
W GNPA+FLRKLTEEE+AFISQSA NYSNLA+VHAAENAKSFDEIEFEK+LRKKFARRDE
Sbjct: 181 WAGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE 240
Query: 241 EYDSMLGVVRETPAELILPDNVMQDKVPK 269
EYDSMLGVVRETP ELILPDN++ DK PK
Sbjct: 241 EYDSMLGVVRETPPELILPDNILPDKAPK 269
|
Length = 269 |
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215263 PLN02472, PLN02472, uncharacterized protein | Back alignment and domain information |
|---|
| >gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|131340 TIGR02287, PaaY, phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >gnl|CDD|184189 PRK13627, PRK13627, carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|100040 cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|215394 PLN02739, PLN02739, serine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225082 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132351 TIGR03308, phn_thr-fam, phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|137467 PRK09677, PRK09677, putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|178297 PLN02694, PLN02694, serine O-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236703 PRK10502, PRK10502, putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| PLN02296 | 269 | carbonate dehydratase | 100.0 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 100.0 | |
| PLN02472 | 246 | uncharacterized protein | 99.97 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.97 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.96 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.95 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.94 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.94 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.94 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.93 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.92 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.92 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.92 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.91 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.91 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.9 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.9 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.89 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.88 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.88 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.88 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.87 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.87 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.87 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.86 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.86 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.86 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.86 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.85 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.84 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.83 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.82 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.82 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.81 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.81 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.8 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.79 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.79 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.78 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.77 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.77 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.77 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.76 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 99.76 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.76 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.75 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.74 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.73 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.73 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.73 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.73 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 99.73 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 99.73 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.72 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.72 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.71 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.71 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.7 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.7 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.69 | |
| PLN02739 | 355 | serine acetyltransferase | 99.68 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.68 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.67 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.67 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.67 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.66 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.66 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.66 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.66 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.66 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.65 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.65 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.63 | |
| PLN02357 | 360 | serine acetyltransferase | 99.63 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 99.63 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.63 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.63 | |
| PLN02296 | 269 | carbonate dehydratase | 99.62 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.61 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.61 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.61 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 99.6 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.59 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.58 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.58 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.57 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.57 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.57 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.56 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.56 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.56 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.55 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.55 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.55 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.54 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.54 | |
| PLN02472 | 246 | uncharacterized protein | 99.54 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.53 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.53 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.53 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.53 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.51 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.49 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.47 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.46 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.46 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.46 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.44 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.42 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.39 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.36 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.33 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.32 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.31 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.3 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.29 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.29 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.28 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.28 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.28 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.27 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.26 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.25 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.25 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.25 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.23 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.2 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.19 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.18 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.18 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.18 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.18 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.18 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.18 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.16 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.15 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.14 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.14 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.14 | |
| PLN02739 | 355 | serine acetyltransferase | 99.13 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.1 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.1 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 99.1 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.08 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.07 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.04 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.04 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.03 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.03 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.03 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.03 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.02 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.98 | |
| PLN02357 | 360 | serine acetyltransferase | 98.97 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.94 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.92 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.9 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.82 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.81 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.79 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.75 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 98.72 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.71 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 98.68 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.64 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.64 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.62 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.6 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.53 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.52 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.51 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.46 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.43 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.42 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.4 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 98.24 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.18 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 97.9 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.87 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 97.86 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.78 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.3 | |
| PF13720 | 83 | Acetyltransf_11: Udp N-acetylglucosamine O-acyltra | 95.45 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 90.1 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 86.7 | |
| PF04519 | 101 | Bactofilin: Polymer-forming cytoskeletal; InterPro | 85.3 |
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-46 Score=325.79 Aligned_cols=269 Identities=91% Similarity=1.392 Sum_probs=258.1
Q ss_pred CchHHHHHHHHHHHHHHHHHHHHhhcccccCchhhhhhhhhhhhhhhhcCCCceECCCCEECCCcEEecCeEECCCCEEc
Q 024153 1 MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIW 80 (271)
Q Consensus 1 m~~~~~~~~~~g~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~i~~~~~I~~~~~i~~~v~IG~~~~I~ 80 (271)
|++|.+++|.+|.|+|+++|++++++.++.+.+.|++.+++++.++.+.+..+.|+++++|+|++.+.+++.||++|.|+
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~e~~~~~~~~~~~~~~~p~I~~~~~I~p~A~V~G~V~IG~~~~I~ 80 (269)
T PLN02296 1 MGTLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFREQLSRHRTLMNIFDKAPVVDKDAFVAPSASVIGDVQVGRGSSIW 80 (269)
T ss_pred CchHHHHHHHHHHHHHhhcchHhhhceeeecchHHHHHHHHHHHHHhhcCCCCccCCCCEECCCcEEEcceEECCCCEEC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCcEEecCCCceEECCCCEECCCCEEecCCcCCCCCccceEEcCCcEECcCcEEeceeeCCCcEEccCcEEccCcEECCC
Q 024153 81 YGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKH 160 (271)
Q Consensus 81 ~~~~I~~~~~~~~IG~~~~I~~~~~I~~~~~~~~~~~~~~~Ig~~~~i~~~~~i~~~~Ig~~~~Ig~~~~I~~~v~Ig~~ 160 (271)
++|+|.++.+++.||++|.|+++|+|+.......+..++++||++|.|++++++++|+||++|+||.+++|.++++|+++
T Consensus 81 ~gavI~g~~~~I~IG~~~~I~d~~vI~~~~~~~~g~~~~siIG~~v~IG~~avI~g~~Igd~v~IG~ga~I~~gv~Ig~~ 160 (269)
T PLN02296 81 YGCVLRGDVNSISVGSGTNIQDNSLVHVAKTNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKH 160 (269)
T ss_pred CCCEEEcCCCceEECCCCEECCCCEEEeCCCcccCCCCCcEeCCCCEECCCceecCCEECCCcEECCCcEECCCeEECCC
Confidence 99999998888999999999999999865444444456899999999999999999999999999999999999999999
Q ss_pred cEEccCcEecCCceeCCCcEEeccCceEccCCCHHHHHHHHHHHHHHHHHHHHHHHHhccchhhHHHHHHHHHHhccchh
Q 024153 161 AMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE 240 (271)
Q Consensus 161 ~~Ig~~svV~~~~~I~~~~vv~G~pa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (271)
++|+++|+|.+++.||++++|.|+||++++++++.++..+...+..|.+++..++.+..+.+++++.++++++++..+++
T Consensus 161 a~IgagSvV~~~~~I~~~~~~~G~PA~~ir~~~~~~~~~~~~~a~~y~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (269)
T PLN02296 161 AMVAAGALVRQNTRIPSGEVWAGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE 240 (269)
T ss_pred CEECCCCEEecCCEeCCCeEEeccCcEEeCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccHHHHHHHHHhhcCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhccccccCCccccCCCccCCCCCCC
Q 024153 241 EYDSMLGVVRETPAELILPDNVMQDKVPK 269 (271)
Q Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 269 (271)
+|++..+..++.||+...|++++++++||
T Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 269 (269)
T PLN02296 241 EYDSMLGVVRETPPELILPDNILPDKAPK 269 (269)
T ss_pred ccccccCcccCCCCcccCCCccccccCCC
Confidence 99999999999999999999999999987
|
|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13720 Acetyltransf_11: Udp N-acetylglucosamine O-acyltransferase; Domain 2; PDB: 3I3A_A 3I3X_A 3HSQ_B 2JF2_A 1LXA_A 2AQ9_A 2QIV_X 2QIA_A 2JF3_A 4EQY_F | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 271 | ||||
| 3ixc_A | 191 | Crystal Structure Of Hexapeptide Transferase Family | 9e-41 | ||
| 3r1w_A | 189 | Crystal Structure Of A Carbonic Anhydrase From A Cr | 3e-32 | ||
| 3tio_A | 183 | Crystal Structures Of Yrda From Escherichia Coli, A | 1e-31 | ||
| 3r3r_A | 187 | Structure Of The Yrda Ferripyochelin Binding Protei | 1e-30 | ||
| 1xhd_A | 173 | X-Ray Crystal Structure Of Putative Acetyltransfera | 2e-27 | ||
| 3vnp_A | 183 | Crystal Structure Of Hypothetical Protein (Gk2848) | 3e-27 | ||
| 1v3w_A | 173 | Structure Of Ferripyochelin Binding Protein From Py | 1e-26 | ||
| 3ou9_A | 213 | Crystal Structure Of Gamma-Carbonic Anhydrase W19f | 2e-08 | ||
| 3otz_A | 213 | Crystal Structure Of Gamma-Carbonic Anhydrase W19a | 2e-08 | ||
| 1qrf_A | 213 | A Closer Look At The Active Site Of Gamma-Carbonic | 3e-08 | ||
| 1thj_A | 214 | Carbonic Anhydrase From Methanosarcina Length = 214 | 3e-08 | ||
| 1qrl_A | 214 | A Closer Look At The Active Site Of Gamma-Carbonic | 3e-08 | ||
| 3otm_A | 212 | Crystal Structures Of Wild-Type Gamma-Carbonic Anhy | 3e-08 | ||
| 1qq0_A | 247 | Cobalt Substituted Carbonic Anhydrase From Methanos | 3e-08 | ||
| 3oup_A | 213 | Crystal Structure Of The Gamma-Carbonic Anhydrase W | 4e-08 | ||
| 3ow5_A | 213 | Crystal Structure Of The Y200a Mutant Of Gamma Carb | 1e-07 | ||
| 3kwc_A | 229 | Oxidized, Active Structure Of The Beta-carboxysomal | 4e-07 | ||
| 3kwd_A | 213 | Inactive Truncation Of The Beta-Carboxysomal Gamma- | 8e-07 | ||
| 3ect_A | 195 | Crystal Structure Of The Hexapeptide-repeat Contain | 6e-04 | ||
| 3fs8_A | 273 | Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Did | 7e-04 |
| >pdb|3IXC|A Chain A, Crystal Structure Of Hexapeptide Transferase Family Protein From Anaplasma Phagocytophilum Length = 191 | Back alignment and structure |
|
| >pdb|3R1W|A Chain A, Crystal Structure Of A Carbonic Anhydrase From A Crude Oil Degrading Psychrophilic Library Length = 189 | Back alignment and structure |
| >pdb|3TIO|A Chain A, Crystal Structures Of Yrda From Escherichia Coli, A Homologous Protein Of Gamma-Class Carbonic Anhydrase, Show Possible Allosteric Conformations Length = 183 | Back alignment and structure |
| >pdb|3R3R|A Chain A, Structure Of The Yrda Ferripyochelin Binding Protein From Salmonella Enterica Length = 187 | Back alignment and structure |
| >pdb|1XHD|A Chain A, X-Ray Crystal Structure Of Putative Acetyltransferase, Product Of Bc4754 Gene [bacillus Cereus] Length = 173 | Back alignment and structure |
| >pdb|3VNP|A Chain A, Crystal Structure Of Hypothetical Protein (Gk2848) From Geobacillus Kaustophilus Length = 183 | Back alignment and structure |
| >pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 | Back alignment and structure |
| >pdb|3OU9|A Chain A, Crystal Structure Of Gamma-Carbonic Anhydrase W19f Mutant From Methanosarcina Thermophila Length = 213 | Back alignment and structure |
| >pdb|3OTZ|A Chain A, Crystal Structure Of Gamma-Carbonic Anhydrase W19a Mutant From Metanosarcina Thermophila Length = 213 | Back alignment and structure |
| >pdb|1QRF|A Chain A, A Closer Look At The Active Site Of Gamma-Carbonic Anhydrases: High Resolution Crystallographic Studies Of The Carbonic Anhydrase From Methanosarcina Thermophila Length = 213 | Back alignment and structure |
| >pdb|1THJ|A Chain A, Carbonic Anhydrase From Methanosarcina Length = 214 | Back alignment and structure |
| >pdb|1QRL|A Chain A, A Closer Look At The Active Site Of Gamma-Carbonic Anhydrases: High Resolution Crystallographic Studies Of The Carbonic Anhydrase From Methanosarcina Thermophila Length = 214 | Back alignment and structure |
| >pdb|3OTM|A Chain A, Crystal Structures Of Wild-Type Gamma-Carbonic Anhydrase From Methanosarcina Thermophila Length = 212 | Back alignment and structure |
| >pdb|1QQ0|A Chain A, Cobalt Substituted Carbonic Anhydrase From Methanosarcina Thermophila Length = 247 | Back alignment and structure |
| >pdb|3OUP|A Chain A, Crystal Structure Of The Gamma-Carbonic Anhydrase W19n Mutant From Methanosarcina Thermophila Length = 213 | Back alignment and structure |
| >pdb|3OW5|A Chain A, Crystal Structure Of The Y200a Mutant Of Gamma Carbonic Anhydrase From Methanosarcina Thermophila Length = 213 | Back alignment and structure |
| >pdb|3KWC|A Chain A, Oxidized, Active Structure Of The Beta-carboxysomal Gamma-carbonic Anhydrase, Ccmm Length = 229 | Back alignment and structure |
| >pdb|3KWD|A Chain A, Inactive Truncation Of The Beta-Carboxysomal Gamma-Carbonic Anhydrase, Ccmm, Form 1 Length = 213 | Back alignment and structure |
| >pdb|3ECT|A Chain A, Crystal Structure Of The Hexapeptide-repeat Containing- Acetyltransferase Vca0836 From Vibrio Cholerae Length = 195 | Back alignment and structure |
| >pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 3e-95 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 3e-94 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 7e-93 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 4e-89 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 2e-81 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 7e-78 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 7e-72 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 3e-27 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 3e-24 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 1e-21 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 3e-20 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 4e-08 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 3e-07 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 4e-19 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 7e-17 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 8e-17 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 5e-13 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 2e-12 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 7e-12 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 2e-11 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 5e-11 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 9e-10 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 2e-09 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 2e-09 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 4e-09 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 4e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 5e-09 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 6e-09 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 6e-08 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 7e-08 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 8e-08 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 1e-04 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 1e-07 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 9e-05 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 2e-07 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 2e-07 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 2e-07 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 5e-07 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 5e-07 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 7e-07 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 1e-06 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 1e-06 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 2e-06 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 3e-05 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 4e-05 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 6e-04 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 5e-05 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 5e-04 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 8e-05 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 8e-05 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 7e-04 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 2e-04 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 4e-04 |
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 | Back alignment and structure |
|---|
Score = 277 bits (710), Expect = 3e-95
Identities = 69/178 (38%), Positives = 107/178 (60%), Gaps = 1/178 (0%)
Query: 44 TLMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDN 103
++ +P + + VF+ S+ IIGDV++G S+W V+RGD++ I IG+ T++QD
Sbjct: 11 SVRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDG 70
Query: 104 SLVHVA-KSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAM 162
S++H+ S+ P IIGD+VT+GH A+LHGCT+ + +GM + ++DG VE +
Sbjct: 71 SVLHITHASDYNPGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVI 130
Query: 163 VAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAK 220
VAAGA V + G V+ G PA+ +R +TE+E +F + A NY L H AE
Sbjct: 131 VAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAEGYD 188
|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Length = 247 | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Length = 252 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Length = 209 | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Length = 203 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Length = 195 | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* Length = 199 | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} Length = 188 | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Length = 190 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Length = 215 | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Length = 182 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Length = 185 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Length = 287 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Length = 267 | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Length = 289 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Length = 313 | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Length = 310 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.97 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.97 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.97 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.97 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.96 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.96 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.94 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.93 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.93 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.93 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.93 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.93 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.93 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.93 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.92 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.92 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.92 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.92 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.92 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.92 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.9 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.9 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.89 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.89 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.89 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.88 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.88 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.88 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.88 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.88 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.88 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.88 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.88 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.88 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.88 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.87 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.87 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.87 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.86 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.86 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.86 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.86 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.85 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.85 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.85 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.85 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 99.84 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.84 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.84 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.84 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.84 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.84 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.83 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.83 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.82 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.8 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.8 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.8 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.79 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.77 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.75 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.75 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.74 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.74 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.74 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.71 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.71 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.71 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.7 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.7 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.69 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.67 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.67 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.67 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.67 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.67 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.66 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.66 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.66 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.66 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.65 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.63 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.61 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.6 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.59 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.58 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.56 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.56 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.56 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.55 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.54 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.54 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.5 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.5 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.5 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.49 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.46 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.44 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.41 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.39 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.38 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.36 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.34 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.34 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.32 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.29 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.27 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.24 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.22 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.21 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.19 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.14 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.14 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.12 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.05 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.97 |
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
Probab=99.97 E-value=3.7e-29 Score=203.85 Aligned_cols=165 Identities=36% Similarity=0.646 Sum_probs=151.8
Q ss_pred hhhcCCCceECCCCEECCCcEEecCeEECCCCEEccCcEEecCCCceEECCCCEECCCCEEecCCcCCCCCccceEEcCC
Q 024153 46 MNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGDN 125 (271)
Q Consensus 46 ~~~~~~~~~i~~~~~I~~~~~i~~~v~IG~~~~I~~~~~I~~~~~~~~IG~~~~I~~~~~I~~~~~~~~~~~~~~~Ig~~ 125 (271)
+.+.+..+.|+++++|+|++.|.+++.||++|.|+++++|.++...+.||++|.|+++|.|.... .+++.||++
T Consensus 6 ~~~~~~~~~ig~~~~I~~~~~i~~~v~IG~~~~I~~~~~i~~~~~~v~IG~~~~I~~~~~I~~~~------~~~~~Ig~~ 79 (173)
T 1xhd_A 6 YPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSP------QYPLILEDD 79 (173)
T ss_dssp ECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECCT------TCCEEECTT
T ss_pred eecCCCCCEECCCcEECCCCEEECCEEECCCcEEcCCcEEecCCCeEEECCCCEECCCCEEEeCC------CCCeEECCC
Confidence 44567788999999999999999999999999999999998765668999999999999998532 247999999
Q ss_pred cEECcCcEEeceeeCCCcEEccCcEEccCcEECCCcEEccCcEecCCceeCCCcEEeccCceEccCCCHHHHHHHHHHHH
Q 024153 126 VTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAI 205 (271)
Q Consensus 126 ~~i~~~~~i~~~~Ig~~~~Ig~~~~I~~~v~Ig~~~~Ig~~svV~~~~~I~~~~vv~G~pa~~~~~~~~~~~~~~~~~~~ 205 (271)
|.|++++.+++++||++||||+++.|.++++||++++|+++++|.++..||+++++.|+||+++++++++.+.++++..+
T Consensus 80 ~~Ig~~~~i~~~~Ig~~~~Ig~~~~i~~~~~Ig~~~~Ig~~s~V~~~~~i~~~~vv~G~pa~~~~~~~~~~~~~~~~~~~ 159 (173)
T 1xhd_A 80 VTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRT 159 (173)
T ss_dssp CEECTTCEEESCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTEEEEETTEEEEEECCHHHHHHHHHHHH
T ss_pred CEECCCCEEeCCEECCCCEEcCCCEEcCCCEECCCCEECCCCEECCCcEeCCCCEEECCCCEECCCCCHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999988889999999999999999999999999999999
Q ss_pred HHHHHHHHHHH
Q 024153 206 NYSNLARVHAA 216 (271)
Q Consensus 206 ~~~~~~~~~~~ 216 (271)
.|..+.+.+.+
T Consensus 160 ~~~~~~~~~~~ 170 (173)
T 1xhd_A 160 QYVEKGQYYKS 170 (173)
T ss_dssp HHHHHHHHHHH
T ss_pred HHHHHHHHHHH
Confidence 99888887643
|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 271 | ||||
| d1v3wa_ | 173 | b.81.1.5 (A:) Ferripyochelin binding protein {Arch | 2e-30 | |
| d1qrea_ | 210 | b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M | 3e-28 | |
| d1xhda_ | 172 | b.81.1.5 (A:) Putative acetyltransferase/acyltrans | 2e-25 | |
| d1xata_ | 208 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo | 2e-15 | |
| d1ocxa_ | 182 | b.81.1.3 (A:) Maltose O-acetyltransferase {Escheri | 4e-14 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 4e-13 | |
| d1krra_ | 200 | b.81.1.3 (A:) Galactoside acetyltransferase {Esche | 3e-11 | |
| d1ssqa_ | 241 | b.81.1.6 (A:) Serine acetyltransferase {Haemophilu | 4e-10 | |
| d1ssqa_ | 241 | b.81.1.6 (A:) Serine acetyltransferase {Haemophilu | 0.001 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 1e-09 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 1e-04 | |
| d3tdta_ | 274 | b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra | 5e-07 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 6e-07 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 2e-06 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 7e-06 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 3e-04 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 0.001 |
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: gamma-carbonic anhydrase-like domain: Ferripyochelin binding protein species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Score = 110 bits (274), Expect = 2e-30
Identities = 61/175 (34%), Positives = 99/175 (56%), Gaps = 9/175 (5%)
Query: 46 MNIF---DKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQD 102
M I+ K P ++ F+ +A +IGDV + +S+W VLRGD+ I +G +N+QD
Sbjct: 1 MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQD 60
Query: 103 NSLVHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAM 162
N +H + PT IG+ VT+GH+A++HG V + +G+ + +LDG + H +
Sbjct: 61 NVSIHTSHGY------PTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVI 114
Query: 163 VAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAE 217
+ AGA+V N +IP + G P + +R+LTEEE+ + ++A Y LA H
Sbjct: 115 IGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKG 169
|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Length = 182 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.97 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.97 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.94 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.93 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.93 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.92 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.89 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.89 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.89 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.88 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.86 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.86 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.85 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.8 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.73 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.68 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.67 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.66 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.62 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.59 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.54 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.5 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.47 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.43 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.43 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.42 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.38 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.37 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.33 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.28 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.12 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 99.12 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.1 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.92 |
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: gamma-carbonic anhydrase-like domain: Putative acetyltransferase/acyltransferase BC4754 species: Bacillus cereus [TaxId: 1396]
Probab=99.97 E-value=1e-29 Score=205.09 Aligned_cols=164 Identities=37% Similarity=0.658 Sum_probs=152.0
Q ss_pred hhhhcCCCceECCCCEECCCcEEecCeEECCCCEEccCcEEecCCCceEECCCCEECCCCEEecCCcCCCCCccceEEcC
Q 024153 45 LMNIFDKAPVVNKDVFLAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPTIIGD 124 (271)
Q Consensus 45 ~~~~~~~~~~i~~~~~I~~~~~i~~~v~IG~~~~I~~~~~I~~~~~~~~IG~~~~I~~~~~I~~~~~~~~~~~~~~~Ig~ 124 (271)
++.+.+..++|+++++|+|++.|.+++.||++|.|+++++|.++...+.||+++.+++++.+..... ++++||+
T Consensus 5 i~~~~~~~~~Ig~~~~I~~~a~I~~~v~IG~~~~Ig~~~~I~~~~~~i~IG~~~~i~~~~~~~~~~~------~~~~ig~ 78 (172)
T d1xhda_ 5 IYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQ------YPLILED 78 (172)
T ss_dssp EECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECCTT------CCEEECT
T ss_pred EEecCCcCCEECCCcEECCCCEEeCCEEECCCcEecCCcccccccccccccceeeeeeeceeccCCc------CCeeeee
Confidence 4556788899999999999999999999999999999999987767789999999999999986433 5799999
Q ss_pred CcEECcCcEEeceeeCCCcEEccCcEEccCcEECCCcEEccCcEecCCceeCCCcEEeccCceEccCCCHHHHHHHHHHH
Q 024153 125 NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSA 204 (271)
Q Consensus 125 ~~~i~~~~~i~~~~Ig~~~~Ig~~~~I~~~v~Ig~~~~Ig~~svV~~~~~I~~~~vv~G~pa~~~~~~~~~~~~~~~~~~ 204 (271)
++.+..++.++++.|+++++|+.+++|.++++||++|+|+++|+|.+++.||++++++|+||++++++++++.+.+++.+
T Consensus 79 ~~~~~~~~~~~~~~i~~~~~ig~~~~i~~gv~IG~~~~IgagsvV~~~~~i~~~~v~~G~Pak~i~~~~~~~~~~~~~~~ 158 (172)
T d1xhda_ 79 DVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIR 158 (172)
T ss_dssp TCEECTTCEEESCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTEEEEETTEEEEEECCHHHHHHHHHHH
T ss_pred eeeeeeeecccccccccceEEecccEeeCCcEEcCcccccceEEEeeCeEECCCeEEEecCcEEECCCCHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999889999999999999999999999999988888
Q ss_pred HHHHHHHHHH
Q 024153 205 INYSNLARVH 214 (271)
Q Consensus 205 ~~~~~~~~~~ 214 (271)
+.|.++.+.+
T Consensus 159 ~~y~~~~k~y 168 (172)
T d1xhda_ 159 TQYVEKGQYY 168 (172)
T ss_dssp HHHHHHHHHH
T ss_pred HHHHHHHHHH
Confidence 8888877655
|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|