Citrus Sinensis ID: 024154


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQVSASSVSF
ccccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccccEEEEEEEcccEEEEEEEEEccEEEEcccccEEEccccEEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccEEccccccccEEEEcHHHHHHHHHHHHHHccccEEEcccccccEEEEEccHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHcccccccccccccccccEEEccccccc
ccccccccccccccccccEEEEEEEEEcccccEEEEEEcccccccccccccccccccEEEEEEEcccccEEEEEEEcccEEccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHccccEEEcccccEEEEEEcccHHHHHHHHHHHccccEccccccccccEEEEEEHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHcccccccccccccccEEEEccccccc
mynsglntghensgvvgsilvpvrfiwpnggrrvslsgsftrwsepmpmspsegcpavfqiicrlppghhqykfyvdgewrhdenqphvsgnygvVNCVYIavpqpdmvpntispetsgnmevddvvmrpegfaqySEADLQLSRDRISSFLSTHTVYEllpdsgkvtaLDVNLAVKQAFHVLYeqglpmvplwddfkgRFVGVLSALDFILILRElgtngsnlteeeLETHTISAWKVGKLQLNLKrqmdgngrpcprplvqvsassvsf
mynsglntghensgvvGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMdgngrpcprplvqvsassvsf
MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQVSASSVSF
*************GVVGSILVPVRFIWPNGGRRVSLSGSFTRW**********GCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQ***************************FAQY**ADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNL*************************
*********************PVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQM****RPCPRPLVQVSASSVSF
*********HENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRW*********EGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQVSASSVSF
****************GSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQP*MVPNT*******N*E**D********AQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQVSA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQVSASSVSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q944A6 487 Sucrose nonfermenting 4-l yes no 0.959 0.533 0.667 2e-99
Q9R078270 5'-AMP-activated protein yes no 0.302 0.303 0.448 8e-13
P80386270 5'-AMP-activated protein yes no 0.302 0.303 0.448 8e-13
Q5BIS9270 5'-AMP-activated protein yes no 0.302 0.303 0.459 1e-12
Q5R801270 5'-AMP-activated protein yes no 0.302 0.303 0.448 2e-12
Q9Y478270 5'-AMP-activated protein yes no 0.302 0.303 0.448 2e-12
P54619 331 5'-AMP-activated protein no no 0.361 0.296 0.393 3e-12
Q09138 330 5'-AMP-activated protein yes no 0.361 0.296 0.393 3e-12
P58108 330 5'-AMP-activated protein no no 0.361 0.296 0.393 3e-12
O54950 330 5'-AMP-activated protein no no 0.361 0.296 0.393 3e-12
>sp|Q944A6|SNF4_ARATH Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana GN=SNF4 PE=1 SV=1 Back     alignment and function desciption
 Score =  362 bits (928), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 181/271 (66%), Positives = 208/271 (76%), Gaps = 11/271 (4%)

Query: 1   MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ 60
           M+ S L++   NS   G +L P RF+WP GGRRV LSGSFTRW+E +PMSP EGCP VFQ
Sbjct: 1   MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ 60

Query: 61  IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSG- 119
           +IC L PG+HQYKF+VDGEWRHDE+QP VSGN GVVN ++I    PDMVP   SPET G 
Sbjct: 61  VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFIT--GPDMVPAGFSPETLGR 118

Query: 120 -NMEVDDVVMRP-----EGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVN 173
            NM+VDDV +R      E   + S  DL+LSR RIS  LST T YELLP+SGKV ALDVN
Sbjct: 119 SNMDVDDVFLRTADPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVN 178

Query: 174 LAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHT 233
           L VKQAFH+LYEQG+P+ PLWD  KG+FVGVL  LDFILILRELGT+GSNLTEEELETHT
Sbjct: 179 LPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHT 238

Query: 234 ISAWKVGKLQLNLKRQMDGNGRPCPRPLVQV 264
           I+AWK GK  ++  RQ DG+GRP PRPLVQV
Sbjct: 239 IAAWKEGKAHIS--RQYDGSGRPYPRPLVQV 267




Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9R078|AAKB1_MOUSE 5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus GN=Prkab1 PE=1 SV=2 Back     alignment and function description
>sp|P80386|AAKB1_RAT 5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus GN=Prkab1 PE=1 SV=4 Back     alignment and function description
>sp|Q5BIS9|AAKB1_BOVIN 5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus GN=PRKAB1 PE=2 SV=3 Back     alignment and function description
>sp|Q5R801|AAKB1_PONAB 5'-AMP-activated protein kinase subunit beta-1 OS=Pongo abelii GN=PRKAB1 PE=2 SV=3 Back     alignment and function description
>sp|Q9Y478|AAKB1_HUMAN 5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens GN=PRKAB1 PE=1 SV=4 Back     alignment and function description
>sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1 Back     alignment and function description
>sp|Q09138|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2 Back     alignment and function description
>sp|P58108|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2 Back     alignment and function description
>sp|O54950|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
359487759 482 PREDICTED: sucrose nonfermenting 4-like 0.955 0.537 0.684 4e-99
18390971 487 sucrose nonfermenting 4-like protein [Ar 0.959 0.533 0.667 1e-97
225450904 488 PREDICTED: sucrose nonfermenting 4-like 0.955 0.530 0.660 2e-97
75037079 394 AKINbetagammaI [Arabidopsis thaliana] 0.959 0.659 0.667 4e-97
297849192 479 hypothetical protein ARALYDRAFT_470981 [ 0.948 0.536 0.676 4e-97
255542654 540 AMP-activated protein kinase, gamma regu 0.944 0.474 0.671 7e-97
312281727 487 unnamed protein product [Thellungiella h 0.959 0.533 0.649 4e-94
225432326 491 PREDICTED: sucrose nonfermenting 4-like 0.959 0.529 0.607 9e-89
356556126 491 PREDICTED: sucrose nonfermenting 4-like 0.959 0.529 0.591 2e-86
224123752 475 predicted protein [Populus trichocarpa] 0.937 0.534 0.623 7e-86
>gi|359487759|ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi|296088362|emb|CBI36807.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 213/266 (80%), Gaps = 7/266 (2%)

Query: 1   MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ 60
           M+ SG  +GHENS + G++L+P RF+WP GGRRV LSGSFTRWSE +PMSP EGCP VFQ
Sbjct: 1   MFVSGAESGHENSAIPGTVLIPTRFVWPYGGRRVLLSGSFTRWSEHIPMSPIEGCPTVFQ 60

Query: 61  IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSG- 119
           +I  L PG+HQYKF+VDGEWRHDE+QP VSGNYGVVN +++   +PD+VP   SP+T G 
Sbjct: 61  VIWSLAPGYHQYKFFVDGEWRHDEHQPFVSGNYGVVNTIFLPR-EPDVVPAVFSPDTPGG 119

Query: 120 -NMEVD-DVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVK 177
            NM++D D   R E   + SEADL++SR R+S FLSTH  YELLP+SGKV ALDVNL VK
Sbjct: 120 SNMDLDNDPFPRGEVIPRISEADLEVSRHRVSEFLSTHIAYELLPESGKVIALDVNLPVK 179

Query: 178 QAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAW 237
           QAFH LYEQG+P+ PLWD  KG+FVGVLSALDFILILRELG +GSNLTEEELETHTISAW
Sbjct: 180 QAFHTLYEQGIPVAPLWDFCKGQFVGVLSALDFILILRELGNHGSNLTEEELETHTISAW 239

Query: 238 KVGKLQLNLKRQMDGNGRPCPRPLVQ 263
           K GKL L   RQ+DG+GR CPR LV 
Sbjct: 240 KEGKLHL---RQIDGSGRLCPRHLVH 262




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|18390971|ref|NP_563834.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] gi|75249553|sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; AltName: Full=CBS domain-containing protein CBSCBS3; AltName: Full=SNF1-related protein kinase regulatory subunit betagamma; Short=AKIN subunit betagamma; Short=AKINbetagamma gi|16612255|gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana] gi|23308443|gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana] gi|75037070|gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana] gi|332190262|gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225450904|ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|75037079|gb|ABA12451.1| AKINbetagammaI [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297849192|ref|XP_002892477.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] gi|297338319|gb|EFH68736.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255542654|ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223548351|gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|312281727|dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|225432326|ref|XP_002274373.1| PREDICTED: sucrose nonfermenting 4-like protein [Vitis vinifera] gi|297736884|emb|CBI26085.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356556126|ref|XP_003546378.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|224123752|ref|XP_002330199.1| predicted protein [Populus trichocarpa] gi|222871655|gb|EEF08786.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:2036079 487 SNF4 "homolog of yeast sucrose 0.959 0.533 0.671 9e-93
MGI|MGI:1336167270 Prkab1 "protein kinase, AMP-ac 0.509 0.511 0.337 7.7e-16
RGD|71057270 Prkab1 "protein kinase, AMP-ac 0.509 0.511 0.337 7.7e-16
UNIPROTKB|Q5BIS9270 PRKAB1 "5'-AMP-activated prote 0.509 0.511 0.344 9.8e-16
UNIPROTKB|E2RH75270 PRKAB1 "Uncharacterized protei 0.509 0.511 0.337 1.6e-15
UNIPROTKB|Q9Y478270 PRKAB1 "5'-AMP-activated prote 0.512 0.514 0.346 1.6e-15
UNIPROTKB|Q27IP4273 PRKAB1 "Uncharacterized protei 0.509 0.505 0.344 4.9e-15
ZFIN|ZDB-GENE-030131-7172260 prkab1b "protein kinase, AMP-a 0.512 0.534 0.344 5.4e-15
ZFIN|ZDB-GENE-040718-377268 prkab1a "protein kinase, AMP-a 0.516 0.522 0.326 2.1e-14
UNIPROTKB|F1RL45270 PRKAB1 "5'-AMP-activated prote 0.509 0.511 0.337 3.8e-14
TAIR|locus:2036079 SNF4 "homolog of yeast sucrose nonfermenting 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 924 (330.3 bits), Expect = 9.0e-93, P = 9.0e-93
 Identities = 182/271 (67%), Positives = 209/271 (77%)

Query:     1 MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ 60
             M+ S L++   NS   G +L P RF+WP GGRRV LSGSFTRW+E +PMSP EGCP VFQ
Sbjct:     1 MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ 60

Query:    61 IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSG- 119
             +IC L PG+HQYKF+VDGEWRHDE+QP VSGN GVVN ++I    PDMVP   SPET G 
Sbjct:    61 VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFIT--GPDMVPAGFSPETLGR 118

Query:   120 -NMEVDDVVMR---P--EGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVN 173
              NM+VDDV +R   P  E   + S  DL+LSR RIS  LST T YELLP+SGKV ALDVN
Sbjct:   119 SNMDVDDVFLRTADPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVN 178

Query:   174 LAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHT 233
             L VKQAFH+LYEQG+P+ PLWD  KG+FVGVL  LDFILILRELGT+GSNLTEEELETHT
Sbjct:   179 LPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHT 238

Query:   234 ISAWKVGKLQLNLKRQMDGNGRPCPRPLVQV 264
             I+AWK GK  ++  RQ DG+GRP PRPLVQV
Sbjct:   239 IAAWKEGKAHIS--RQYDGSGRPYPRPLVQV 267




GO:0005634 "nucleus" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0030295 "protein kinase activator activity" evidence=ISS
GO:0042149 "cellular response to glucose starvation" evidence=IDA
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
MGI|MGI:1336167 Prkab1 "protein kinase, AMP-activated, beta 1 non-catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71057 Prkab1 "protein kinase, AMP-activated, beta 1 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BIS9 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH75 PRKAB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y478 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q27IP4 PRKAB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7172 prkab1b "protein kinase, AMP-activated, beta 1 non-catalytic subunit, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-377 prkab1a "protein kinase, AMP-activated, beta 1 non-catalytic subunit, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL45 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
SNF4
SNF4 (HOMOLOG OF YEAST SUCROSE NONFERMENTING 4); protein kinase activator; putative activator subunit of SNF1-related protein kinase (487 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AKIN11
AKIN11 (Arabidopsis SNF1 kinase homolog 11); protein binding / protein kinase; encodes a SNF1-r [...] (512 aa)
      0.998
AKIN10
AKIN10 (Arabidopsis SNF1 kinase homolog 10); protein binding / protein kinase; encodes a SNF1-r [...] (535 aa)
     0.995
SnRK1.3
SnRK1.3 (SNF1-RELATED PROTEIN KINASE 1.3); ATP binding / kinase/ protein kinase/ protein serine [...] (494 aa)
       0.944
AT5G21170
5'-AMP-activated protein kinase beta-2 subunit, putative; 5'-AMP-activated protein kinase beta- [...] (320 aa)
      0.935
AT2G28060
protein kinase-related; protein kinase-related; FUNCTIONS IN- molecular_function unknown; INVOL [...] (114 aa)
      0.911
DL4210W
AMP-activated protein kinase; AMP-activated protein kinase; FUNCTIONS IN- AMP-activated protein [...] (259 aa)
     0.879
XRCC4
XRCC4; protein C-terminus binding; A. thaliana homologue of the human DNA ligase IV-binding pro [...] (264 aa)
       0.869
AT3G55840
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unkn [...] (428 aa)
       0.859
HSPRO2
HSPRO2 (ARABIDOPSIS ORTHOLOG OF SUGAR BEET HS1 PRO-1 2); ARABIDOPSIS ORTHOLOG OF SUGAR BEET HS1 [...] (435 aa)
       0.859
CINV1
CINV1 (cytosolic invertase 1); beta-fructofuranosidase; Encodes a protein with cytosolic (alkal [...] (551 aa)
       0.859

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
cd0285980 cd02859, E_set_AMPKbeta_like_N, N-terminal Early s 6e-27
cd0461898 cd04618, CBS_pair_5, The CBS domain, named after h 2e-16
cd0718486 cd07184, E_set_Isoamylase_like_N, N-terminal Early 1e-06
cd0268882 cd02688, E_set, Early set domain associated with t 5e-06
>gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit Back     alignment and domain information
 Score = 99.6 bits (249), Expect = 6e-27
 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 22 PVRFIWPN-GGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEW 80
          PV F WP  GG+ V ++GSF  W +P+P+  S      F     LPPG ++YKF VDGEW
Sbjct: 1  PVTFRWPGPGGKEVYVTGSFDNWQQPIPLEKSGDG--EFSATVELPPGRYEYKFIVDGEW 58

Query: 81 RHDENQPHVSGNYGVVN 97
           HD + P V+  +G +N
Sbjct: 59 VHDPDLPTVTDEFGNLN 75


E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase. Length = 80

>gnl|CDD|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins Back     alignment and domain information
>gnl|CDD|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
cd0285979 AMPKbeta_GBD_like AMP-activated protein kinase (AM 99.92
KOG1764 381 consensus 5'-AMP-activated protein kinase, gamma s 99.8
cd0286182 E_set_proteins_like E or "early" set-like proteins 99.79
KOG1616289 consensus Protein involved in Snf1 protein kinase 99.67
cd0285885 Esterase_N_term Esterase N-terminal domain. Estera 99.27
cd0268883 E_set E or "early" set of sugar utilizing enzymes 98.84
cd0285499 Glycogen_branching_enzyme_like_N_term Glycogen bra 98.48
PF0292285 CBM_48: Carbohydrate-binding module 48 (Isoamylase 98.33
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.06
cd02860100 Pullulanase_N_term Pullulanase domain N-terminus. 97.92
PF0068696 CBM_20: Starch binding domain; InterPro: IPR002044 97.75
cd0580895 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 97.71
cd02855106 Glycogen_branching_enzyme_N_term Glycogen branchin 97.71
cd02856103 Glycogen_debranching_enzyme_N_term Glycogen_debran 97.64
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 97.63
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 97.52
PRK12568 730 glycogen branching enzyme; Provisional 97.33
PLN02447 758 1,4-alpha-glucan-branching enzyme 97.32
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 97.3
cd0581892 CBM20_water_dikinase Phosphoglucan water dikinase 97.29
PRK12313 633 glycogen branching enzyme; Provisional 97.24
cd02852119 Isoamylase_N_term Isoamylase N-terminus domain. Is 97.21
cd0581395 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 97.17
PRK14706 639 glycogen branching enzyme; Provisional 97.16
cd0580999 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 97.1
PRK14705 1224 glycogen branching enzyme; Provisional 97.05
cd05820103 CBM20_novamyl Novamyl (also known as acarviose tra 97.05
cd05814120 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- 97.01
PRK05402 726 glycogen branching enzyme; Provisional 96.89
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 96.87
cd0285385 MTHase_N_term Maltooligosyl trehalose synthase (MT 96.74
cd05811106 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g 96.72
cd0546796 CBM20 The family 20 carbohydrate-binding module (C 96.6
cd05817100 CBM20_DSP Dual-specificity phosphatase (DSP), N-te 96.57
cd0581699 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP 96.56
COG2524294 Predicted transcriptional regulator, contains C-te 96.51
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.48
PRK05402 726 glycogen branching enzyme; Provisional 96.47
cd05807101 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat 96.31
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 96.14
cd0581097 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol 96.12
PF11806122 DUF3327: Domain of unknown function (DUF3327); Int 95.91
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 95.73
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 95.67
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 95.64
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 95.56
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 95.49
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 95.47
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 95.34
cd02205113 CBS_pair The CBS domain, named after human CBS, is 95.29
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 95.27
cd05815101 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP 95.22
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 95.14
cd05806112 CBM20_laforin Laforin protein tyrosine phosphatase 95.1
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 95.08
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 95.06
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 95.01
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 94.99
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 94.99
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 94.97
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 94.94
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 94.94
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 94.84
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 94.82
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 94.8
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 94.79
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 94.75
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 94.72
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 94.67
PF0342387 CBM_25: Carbohydrate binding domain (family 25); I 94.63
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 94.62
PLN02316 1036 synthase/transferase 94.57
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 94.55
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 94.52
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 94.51
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 94.49
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 94.47
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 94.46
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 94.45
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 94.45
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 94.43
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 94.38
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 94.33
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 94.3
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 94.27
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 94.27
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 94.24
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 94.23
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 94.21
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 94.14
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 94.13
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 94.09
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 94.07
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 94.07
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 94.03
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 94.03
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 94.02
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 93.96
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 93.94
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 93.93
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 93.9
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 93.89
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 93.87
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 93.81
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 93.78
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 93.77
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 93.72
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 93.71
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 93.7
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 93.67
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 93.65
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 93.65
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 93.6
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 93.59
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 93.56
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 93.47
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 93.46
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 93.41
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 93.4
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 93.39
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 93.37
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 93.29
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 93.27
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 93.25
PLN02960 897 alpha-amylase 93.12
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 93.06
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 93.05
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 93.02
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 92.88
PLN02950 909 4-alpha-glucanotransferase 92.79
PLN02950 909 4-alpha-glucanotransferase 92.73
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 92.73
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 92.69
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 92.68
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 92.66
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 92.65
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 92.63
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 92.58
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 92.52
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 92.51
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 92.48
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 92.37
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 92.35
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 92.34
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 92.2
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 92.19
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 92.13
PLN02316 1036 synthase/transferase 92.01
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 92.0
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 91.91
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 91.88
COG0517117 FOG: CBS domain [General function prediction only] 91.84
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 91.78
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 91.71
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 91.69
cd02205113 CBS_pair The CBS domain, named after human CBS, is 91.63
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 91.58
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 91.47
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 91.41
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 91.38
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 91.32
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 91.31
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 91.31
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 91.31
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 91.18
COG3448382 CBS-domain-containing membrane protein [Signal tra 91.08
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 91.05
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 91.04
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 90.99
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 90.91
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 90.89
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 90.83
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 90.74
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 90.61
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 90.57
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 90.38
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 89.85
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 89.85
PRK03705 658 glycogen debranching enzyme; Provisional 89.55
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 89.36
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 89.23
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 89.08
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 89.07
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 89.05
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 88.72
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 88.45
PRK11573 413 hypothetical protein; Provisional 87.77
COG0517117 FOG: CBS domain [General function prediction only] 87.48
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 87.45
PLN02274 505 inosine-5'-monophosphate dehydrogenase 86.97
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 86.48
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 86.44
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 86.25
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 85.83
PRK14869 546 putative manganese-dependent inorganic pyrophospha 85.79
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 84.0
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 83.84
PRK01862574 putative voltage-gated ClC-type chloride channel C 83.82
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 83.78
cd02857116 CD_pullulan_degrading_enzymes_N_term CD and pullul 83.71
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 82.01
PLN03244 872 alpha-amylase; Provisional 81.61
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 81.57
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 81.16
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 80.97
PRK01862574 putative voltage-gated ClC-type chloride channel C 80.5
PRK14869 546 putative manganese-dependent inorganic pyrophospha 80.17
>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) Back     alignment and domain information
Probab=99.92  E-value=4.5e-25  Score=168.01  Aligned_cols=79  Identities=46%  Similarity=0.944  Sum_probs=73.9

Q ss_pred             ceEEEEEecCCCceEEEEeccCCCCCCCCCCCCCCCCCeEEEEEecCCceEEEEEEEcCeeecCCCCCeeeCCCCccccE
Q 024154           20 LVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCV   99 (271)
Q Consensus        20 ~vpVtF~w~~~ak~V~V~GsF~nW~~~ipM~k~~~~~g~f~~~~~LppG~yeYKFiVDG~W~~Dp~~P~v~d~~G~~NNv   99 (271)
                      .++|+|+|.++|++|+|+|||++|++..||.+..  .+ |++++.||||.|+|||+|||+|.+||++|++.|++|+.||+
T Consensus         1 ~~~v~f~~~~~a~~V~v~G~F~~W~~~~pm~~~~--~~-~~~~~~L~~g~y~YkF~Vdg~w~~d~~~~~~~d~~G~~NN~   77 (79)
T cd02859           1 MVPTTFVWPGGGKEVYVTGSFDNWKKKIPLEKSG--KG-FSATLRLPPGKYQYKFIVDGEWRHSPDLPTETDDEGNVNNV   77 (79)
T ss_pred             CeEEEEEEcCCCcEEEEEEEcCCCCccccceECC--CC-cEEEEEcCCCCEEEEEEECCEEEeCCCCCccCCCCCcEeee
Confidence            4799999999999999999999999878999875  34 99999999999999999999999999999999999999999


Q ss_pred             EE
Q 024154          100 YI  101 (271)
Q Consensus       100 l~  101 (271)
                      |+
T Consensus        78 i~   79 (79)
T cd02859          78 ID   79 (79)
T ss_pred             EC
Confidence            84



AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as a alpha-beta-gamma heterotrimer. This domain is the glycogen binding domain of the beta subunit.

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>cd02861 E_set_proteins_like E or "early" set-like proteins Back     alignment and domain information
>KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02858 Esterase_N_term Esterase N-terminal domain Back     alignment and domain information
>cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies Back     alignment and domain information
>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain Back     alignment and domain information
>PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>cd02860 Pullulanase_N_term Pullulanase domain N-terminus Back     alignment and domain information
>PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain Back     alignment and domain information
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd02852 Isoamylase_N_term Isoamylase N-terminus domain Back     alignment and domain information
>cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain Back     alignment and domain information
>cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) Back     alignment and domain information
>cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1z0m_A96 The Glycogen-Binding Domain Of The Amp-Activated Pr 3e-14
1z0n_A96 The Glycogen-Binding Domain Of The Amp-Activated Pr 8e-14
2v8q_E 330 Crystal Structure Of The Regulatory Fragment Of Mam 4e-13
2f15_A96 Glycogen-Binding Domain Of The Amp-Activated Protei 9e-13
2qlv_B252 Crystal Structure Of The Heterotrimer Core Of The S 3e-11
3t4n_C 323 Structure Of The Regulatory Fragment Of Saccharomyc 7e-10
2qlv_C 315 Crystal Structure Of The Heterotrimer Core Of The S 8e-10
2qr1_G 334 Crystal Structure Of The Adenylate Sensor From Amp- 7e-07
2oox_G 333 Crystal Structure Of The Adenylate Sensor From Amp- 7e-07
3nme_A294 Structure Of A Plant Phosphatase Length = 294 3e-06
>pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 Back     alignment and structure

Iteration: 1

Score = 75.5 bits (184), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 39/87 (44%), Positives = 52/87 (59%), Gaps = 5/87 (5%) Query: 22 PVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWR 81 P F W GG+ V LSGSF WS+ +P++ S+ F I LP G HQYKF+VDG+W Sbjct: 12 PTVFRWTGGGKEVYLSGSFNNWSK-LPLTRSQNN---FVAILDLPEGEHQYKFFVDGQWT 67 Query: 82 HDENQPHVSGNYGVVNCVYIAVPQPDM 108 HD ++P V+ G VN + I V + D Sbjct: 68 HDPSEPIVTSQLGTVNNI-IQVKKTDF 93
>pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 Back     alignment and structure
>pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330 Back     alignment and structure
>pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 Back     alignment and structure
>pdb|2QLV|B Chain B, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 252 Back     alignment and structure
>pdb|3T4N|C Chain C, Structure Of The Regulatory Fragment Of Saccharomyces Cerevisiae Ampk In Complex With Adp Length = 323 Back     alignment and structure
>pdb|2QLV|C Chain C, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 315 Back     alignment and structure
>pdb|2QR1|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-Activated Protein Kinase In Complex With Adp Length = 334 Back     alignment and structure
>pdb|2OOX|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-activated Protein Kinase Complexed With Amp Length = 333 Back     alignment and structure
>pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
2qlv_B252 Protein SIP2, protein SPM2; heterotrimer, ATP-bind 3e-29
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 7e-26
1z0n_A96 5'-AMP-activated protein kinase, beta-1 subunit; b 5e-25
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 5e-25
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 9e-22
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-21
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 8e-12
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 1e-04
>2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 Back     alignment and structure
 Score =  110 bits (274), Expect = 3e-29
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 1/139 (0%)

Query: 18  SILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVD 77
           S++VPV   W  GG +V ++GSFT+W + + + P       F +  RL PG H+++F VD
Sbjct: 1   SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVD 60

Query: 78  GEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYS 137
            E R  +  P  +   G     YI V QP+  P      +     +          A   
Sbjct: 61  NELRVSDFLPTATDQMGNFVN-YIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQI 119

Query: 138 EADLQLSRDRISSFLSTHT 156
             D     D  + F    +
Sbjct: 120 GKDPDDFGDGYTRFHEDLS 138


>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
1z0n_A96 5'-AMP-activated protein kinase, beta-1 subunit; b 99.91
2qlv_B252 Protein SIP2, protein SPM2; heterotrimer, ATP-bind 99.89
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.87
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.7
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 99.58
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.25
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.16
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 99.09
2z0b_A131 GDE5, KIAA1434, putative glycerophosphodiester pho 98.43
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.3
1ac0_A108 Glucoamylase; hydrolase, starch binding domain; HE 97.84
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 97.82
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 97.64
4esy_A170 CBS domain containing membrane protein; structural 97.61
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 97.6
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 97.49
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 97.31
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.12
3fio_A70 A cystathionine beta-synthase domain protein fused 97.09
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 96.96
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 96.95
3ddj_A 296 CBS domain-containing protein; structural genomics 96.92
3ocm_A173 Putative membrane protein; structural genomics, PS 96.7
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 96.61
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 96.6
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 96.6
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 96.58
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 96.56
3lqn_A150 CBS domain protein; csgid, structural genomics, un 96.53
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 96.48
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 96.45
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 96.44
3oco_A153 Hemolysin-like protein containing CBS domains; str 96.44
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 96.41
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 96.4
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 96.37
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 96.37
2laa_A104 Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa 96.35
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 96.31
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 96.29
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 96.29
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 96.23
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 96.21
1pbj_A125 Hypothetical protein; structural genomics, domain, 96.17
3oco_A153 Hemolysin-like protein containing CBS domains; str 96.16
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 96.15
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 96.14
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 96.13
2o16_A160 Acetoin utilization protein ACUB, putative; struct 96.12
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 96.06
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 96.06
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 96.03
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 96.01
1pbj_A125 Hypothetical protein; structural genomics, domain, 96.01
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 95.97
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 95.97
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 95.97
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 95.96
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 95.96
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 95.95
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 95.95
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 95.92
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 95.91
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 95.87
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 95.86
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 95.83
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 95.81
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 95.75
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 95.74
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 95.73
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 95.73
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 95.72
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 95.69
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 95.68
1o50_A157 CBS domain-containing predicted protein TM0935; CB 95.66
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 95.64
4fry_A157 Putative signal-transduction protein with CBS DOM; 95.63
2vn4_A599 Glucoamylase; hydrolase, carbohydrate binding, gly 95.63
4fry_A157 Putative signal-transduction protein with CBS DOM; 95.6
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 95.58
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 95.55
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 95.55
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 95.53
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 95.49
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 95.47
1o50_A157 CBS domain-containing predicted protein TM0935; CB 95.46
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 95.43
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 95.43
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 95.42
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 95.4
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 95.39
3lqn_A150 CBS domain protein; csgid, structural genomics, un 95.32
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 95.26
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 95.25
3ocm_A173 Putative membrane protein; structural genomics, PS 95.25
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 95.24
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 95.2
4esy_A170 CBS domain containing membrane protein; structural 95.19
2o16_A160 Acetoin utilization protein ACUB, putative; struct 95.06
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 95.05
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 94.95
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 94.77
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 94.75
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 94.75
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 94.75
1vr9_A213 CBS domain protein/ACT domain protein; structural 94.74
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 94.64
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 94.61
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 94.6
3kxr_A205 Magnesium transporter, putative; cystathionine bet 94.57
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 94.34
1pvm_A184 Conserved hypothetical protein TA0289; structural 94.26
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 94.15
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 94.09
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 94.01
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 93.93
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 93.9
2oux_A286 Magnesium transporter; 10001B, structural genomics 93.73
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 93.71
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 93.7
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 93.7
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 93.67
1pvm_A184 Conserved hypothetical protein TA0289; structural 93.66
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 93.52
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 93.48
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 93.34
3ddj_A296 CBS domain-containing protein; structural genomics 93.25
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 93.13
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 92.96
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 92.88
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 92.81
3kxr_A205 Magnesium transporter, putative; cystathionine bet 92.42
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 92.27
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 92.21
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 91.13
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 90.59
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 90.26
1vr9_A213 CBS domain protein/ACT domain protein; structural 89.74
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 89.64
4fch_A221 Outer membrane protein SUSE; starch binding, extra 87.91
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 87.77
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 87.46
2c3v_A102 Alpha-amylase G-6; carbohydrate-binding module, st 87.1
2oux_A286 Magnesium transporter; 10001B, structural genomics 85.88
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 85.55
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 85.34
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 85.33
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 84.41
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 83.96
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 82.08
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 81.09
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 80.26
>1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Back     alignment and structure
Probab=99.91  E-value=2.8e-24  Score=168.21  Aligned_cols=82  Identities=45%  Similarity=0.872  Sum_probs=75.8

Q ss_pred             CCcceEEEEEecCCCceEEEEeccCCCCCCCCCCCCCCCCCeEEEEEecCCceEEEEEEEcCeeecCCCCCeeeCCCCcc
Q 024154           17 GSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVV   96 (271)
Q Consensus        17 ~~~~vpVtF~w~~~ak~V~V~GsF~nW~~~ipM~k~~~~~g~f~~~~~LppG~yeYKFiVDG~W~~Dp~~P~v~d~~G~~   96 (271)
                      .+.+++|+|+|..+|++|+|+|+||+|+ .++|.+.   .|.|++++.|++|.|+|||+|||+|++||.+|++.|+.|+.
T Consensus         7 ~~~~~~v~F~wap~a~~V~v~GdFn~W~-~~~m~~~---~g~w~~~v~l~~G~~~YKf~VdG~~~~DP~~~~~~d~~G~~   82 (96)
T 1z0n_A            7 PAQARPTVFRWTGGGKEVYLSGSFNNWS-KLPMTRS---QNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTV   82 (96)
T ss_dssp             ---CEEEEEEECSCCSCEEEEEGGGTTC-CEECEEE---TTEEEEEEEECSEEEEEEEEETTEEECCTTSCEEECTTSCE
T ss_pred             CCCceEEEEEECCCCcEEEEEEEeCCCc-cccCEEC---CCEEEEEEEccCCCEEEEEEECCeEEcCCCCCeEECCCCCE
Confidence            4567999999999999999999999999 7899984   47999999999999999999999999999999999999999


Q ss_pred             ccEEEe
Q 024154           97 NCVYIA  102 (271)
Q Consensus        97 NNvl~V  102 (271)
                      ||+|.|
T Consensus        83 Nnvi~V   88 (96)
T 1z0n_A           83 NNIIQV   88 (96)
T ss_dssp             EEEEEE
T ss_pred             eEEEEE
Confidence            999999



>2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>4fch_A Outer membrane protein SUSE; starch binding, extracellular, carbohydrate-B protein; HET: GLC; 1.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2c3v_A Alpha-amylase G-6; carbohydrate-binding module, starch binding, carbohydrate binding, glycoside hydrolase, amylose, amylopectin; HET: TYI; 1.39A {Bacillus halodurans} PDB: 2c3v_B* 2c3w_A* 2c3x_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d2qlvb187 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi 2e-24
d1z0na187 b.1.18.21 (A:77-163) 5'-AMP-activated protein kina 4e-24
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 3e-10
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 2e-07
>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: AMPK-beta glycogen binding domain-like
domain: SIP2
species: Saccharomyces cerevisiae [TaxId: 4932]
 Score = 91.7 bits (227), Expect = 2e-24
 Identities = 27/82 (32%), Positives = 42/82 (51%)

Query: 18 SILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVD 77
          S++VPV   W  GG +V ++GSFT+W + + + P       F +  RL PG H+++F VD
Sbjct: 1  SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVD 60

Query: 78 GEWRHDENQPHVSGNYGVVNCV 99
           E R  +  P  +   G     
Sbjct: 61 NELRVSDFLPTATDQMGNFVNY 82


>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d2qlvb187 SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} 99.95
d1z0na187 5'-AMP-activated protein kinase subunit beta-1 {Ra 99.94
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.79
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.62
d1m7xa1110 1,4-alpha-glucan branching enzyme, N-terminal doma 98.56
d2bhua197 Glycosyltrehalose trehalohydrolase, N-terminal dom 98.45
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.07
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.03
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.03
d1eh9a190 Glycosyltrehalose trehalohydrolase, N-terminal dom 97.78
d1kula_108 Glucoamylase, granular starch-binding domain {Aspe 97.77
d3bmva2105 Cyclodextrin glycosyltransferase, C-terminal domai 97.77
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 97.68
d1qhoa2110 Cyclodextrin glycosyltransferase, C-terminal domai 97.6
d1cyga2106 Cyclodextrin glycosyltransferase, C-terminal domai 97.57
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 97.43
d1vema199 beta-amylase {Bacillus cereus [TaxId: 1396]} 97.32
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 97.23
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 97.15
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 97.05
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 96.94
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 96.76
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 96.74
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 96.68
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 96.66
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 96.58
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 96.3
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 96.07
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 96.05
d1bf2a1162 Isoamylase, N-terminal domain N {Pseudomonas amylo 95.93
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 95.88
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 95.86
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 95.85
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 95.82
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 95.8
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 95.79
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 95.76
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 95.75
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 95.73
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 95.67
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 95.64
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 95.62
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 95.59
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 95.5
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 95.49
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 95.48
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 95.39
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 95.08
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 95.02
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 94.93
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 94.9
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 94.88
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 94.7
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 94.48
d2fhfa1115 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 94.41
d3c8da1145 Enterochelin esterase {Shigella flexneri 2a str. 2 94.3
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 94.27
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 94.07
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 93.8
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 92.86
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 91.82
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 90.76
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 82.87
d1ji1a1122 Maltogenic amylase, N-terminal domain N {Thermoact 82.27
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 81.55
d1wzla1120 Maltogenic amylase, N-terminal domain N {Thermoact 80.37
>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: AMPK-beta glycogen binding domain-like
domain: SIP2
species: Saccharomyces cerevisiae [TaxId: 4932]
Probab=99.95  E-value=6.2e-28  Score=183.59  Aligned_cols=84  Identities=31%  Similarity=0.647  Sum_probs=78.2

Q ss_pred             cceEEEEEecCCCceEEEEeccCCCCCCCCCCCCCCCCCeEEEEEecCCceEEEEEEEcCeeecCCCCCeeeCCCCcccc
Q 024154           19 ILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNC   98 (271)
Q Consensus        19 ~~vpVtF~w~~~ak~V~V~GsF~nW~~~ipM~k~~~~~g~f~~~~~LppG~yeYKFiVDG~W~~Dp~~P~v~d~~G~~NN   98 (271)
                      .++||+|+|+++|++|+|+||||+|++..+|.+....+|.|++++.|+||.|+|||+|||+|++||++|++.|+.|+.||
T Consensus         2 ~~vpv~f~w~~~g~~V~v~GsFn~W~~~~~~~~~~~~~g~~~~~l~l~~G~y~YKFiVDG~w~~d~~~p~~~d~~G~~nn   81 (87)
T d2qlvb1           2 LMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVN   81 (87)
T ss_dssp             CCEEEEEEECSCCSCEEEEEGGGTTSSCEECEECSSSTTCEEEEEEECSEEEEEEEEETTEEECCTTSCEEBCSSCCCEE
T ss_pred             eEEEEEEEECCCCeEEEEEEEecCcCcccccccccCCCccEEEEEeCCCCCEEEEEEECCcEEcCCCCCeeECCCCCEeE
Confidence            46999999999999999999999999887776654457899999999999999999999999999999999999999999


Q ss_pred             EEEe
Q 024154           99 VYIA  102 (271)
Q Consensus        99 vl~V  102 (271)
                      +|.|
T Consensus        82 vi~V   85 (87)
T d2qlvb1          82 YIEV   85 (87)
T ss_dssp             EEEE
T ss_pred             EEEE
Confidence            9999



>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ji1a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzla1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure